P15814 · IGLL1_HUMAN
- ProteinImmunoglobulin lambda-like polypeptide 1
- GeneIGLL1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids213 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Critical for B-cell development.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum | |
Cellular Component | extracellular region | |
Cellular Component | IgG immunoglobulin complex | |
Cellular Component | membrane | |
Molecular Function | antigen binding | |
Biological Process | immune response | |
Biological Process | immunoglobulin mediated immune response |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameImmunoglobulin lambda-like polypeptide 1
- Alternative names
- CD Antigen Name
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP15814
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: In pre-B cells, localizes predominantly to the endoplasmic reticulum.
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Agammaglobulinemia 2, autosomal recessive (AGM2)
- Note
- DescriptionA primary immunodeficiency characterized by profoundly low or absent serum antibodies and low or absent circulating B cells due to an early block of B-cell development. Affected individuals develop severe infections in the first years of life.
- See alsoMIM:613500
Natural variants in AGM2
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_034869 | 142 | P>L | in AGM2; dbSNP:rs1064422 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_034869 | 142 | in AGM2; dbSNP:rs1064422 | |||
Sequence: P → L | ||||||
Natural variant | VAR_059392 | 189 | in dbSNP:rs8138122 | |||
Sequence: R → H |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 317 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-37 | |||||
Sequence: MRPGTGQGGLEAPGEPGPNLRQRWPLLLLGLAVVTHG | ||||||
Chain | PRO_0000014777 | 38-213 | Immunoglobulin lambda-like polypeptide 1 | |||
Sequence: LLRPTAASQSRALGPGAPGGSSRSSLRSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS | ||||||
Disulfide bond | 135↔194 | |||||
Sequence: CLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSC | ||||||
Disulfide bond | 212 | Interchain (with a heavy chain) | ||||
Sequence: C |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed only in pre-B-cells and a special B-cell line (which is surface Ig negative).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Associates non-covalently with VPREB1 (PubMed:17431183).
Interacts with SYNV1/HRD1 (via N-terminus); this interaction leads to increased IGLL1 ubiquitination and degradation in pre-B cells, possibly through a lysosomal, not proteasomal, pathway (By similarity).
Interacts with SYNV1/HRD1 (via N-terminus); this interaction leads to increased IGLL1 ubiquitination and degradation in pre-B cells, possibly through a lysosomal, not proteasomal, pathway (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
XENO | P15814 | ECH_0166 Q2GHU2 | 2 | EBI-1222221, EBI-26585631 | |
BINARY | P15814 | FAM25C B3EWG5 | 3 | EBI-1222221, EBI-14240149 | |
BINARY | P15814 | UBQLN2 Q9UHD9 | 3 | EBI-1222221, EBI-947187 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 97-108 | J region | ||||
Sequence: VFGSGTQLTVLS | ||||||
Region | 109-213 | C region | ||||
Sequence: QPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS | ||||||
Domain | 114-208 | Ig-like C1-type | ||||
Sequence: PSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVA |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
P15814-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length213
- Mass (Da)22,963
- Last updated1990-04-01 v1
- Checksum9133A7742B943C79
P15814-2
- Name2
- Differences from canonical
- 70-213: FLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS → SAQGHPLGHSVPAVL
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
C9JEE0 | C9JEE0_HUMAN | IGLL1 | 180 |
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_042748 | 70-213 | in isoform 2 | |||
Sequence: FLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFPPSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLSLTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS → SAQGHPLGHSVPAVL |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M27749 EMBL· GenBank· DDBJ | AAA36100.1 EMBL· GenBank· DDBJ | mRNA | ||
M34513 EMBL· GenBank· DDBJ | AAA36096.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M34511 EMBL· GenBank· DDBJ | AAA36096.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M34512 EMBL· GenBank· DDBJ | AAA36096.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP000345 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC030239 EMBL· GenBank· DDBJ | AAH30239.2 EMBL· GenBank· DDBJ | mRNA | ||
BC012293 EMBL· GenBank· DDBJ | AAH12293.1 EMBL· GenBank· DDBJ | mRNA | ||
X03528 EMBL· GenBank· DDBJ | CAA27229.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X03530 EMBL· GenBank· DDBJ | CAA27231.1 EMBL· GenBank· DDBJ | Genomic DNA |