P15533 · TR30A_MOUSE
- ProteinTripartite motif-containing protein 30A
- GeneTrim30a
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids496 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Trans-acting factor that regulates gene expression of interleukin 2 receptor alpha chain. May affect IL2R-alpha expression through cis-acting negative regulatory elements or through competition with proteins that bind to enhancer or activator sequences. Negatively regulates Toll-like receptor (TLR)-mediated activation of NFKB by promoting degradation of TAB2 and TAB3 and preventing TRAF6 autoubiquitination. Negatively regulates production of reactive oxygen species (ROS) which inhibits activation of the NLRP3 inflammasome complex. This, in turn, regulates activation of CASP1 and subsequent cleavage of IL1B and IL18. No activity detected against a range of retroviruses including a number of lentiviruses, gammaretroviruses and betaretroviruses.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameTripartite motif-containing protein 30A
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP15533
- Secondary accessions
Proteomes
Organism-specific databases
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 35 | Reduced interaction with NR2C2 and enhanced interaction with TAB2 and TAB3. Does not decrease TAB2 or TAB3 expression. No effect on inhibition of ROS or negative regulation of NLRP3 inflammasome activation. | ||||
Sequence: C → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 58 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000056244 | 1-496 | Tripartite motif-containing protein 30A | |||
Sequence: MASSVLEMIKEEVTCPICLELLKEPVSADCNHSFCRACITLNYESNRNTDGKGNCPVCRVPYPFGNLRPNLHVANIVERLKGFKSIPEEEQKVNICAQHGEKLRLFCRKDMMVICWLCERSQEHRGHQTALIEEVDQEYKEKLQGALWKLMKKAKICDEWQDDLQLQRVDWENQIQINVENVQRQFKGLRDLLDSKENEELQKLKKEKKEVMEKLEESENELEDQTELVRDLISDVEHHLELSTLEMLQGANCVLRRSQSLSLQQPQTVPQKRKRTFQAPDLKGMLQVYQGLMDIQQYWVHMTLHARNNAVIAINKEKRQIQYRSYNTVPVSEIYHLGVLGYPALSSGKHYWEVDISRSDAWLLGLNDGKCAQPQLHSKEEMGIKKNLHSQIKQNVLFQPKCGYWVIGMKNPSVYKAFDECSITHNSSILVISLPDRPSRVGVFLDRKAGTLSFYDVSNCGALIYRFYDPAFPVEVYPYFNPMKCSEPMTICGPPS |
Proteomic databases
PTM databases
Expression
Tissue specificity
Highly expressed in spleen and lymph nodes (at protein level).
Induction
By the TLR ligands lipopolysaccharide, CpG dinucleotide and polyinosinic-polycytidylic acid.
Gene expression databases
Structure
Family & Domains
Features
Showing features for zinc finger, coiled coil, region, motif, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Zinc finger | 15-59 | RING-type | ||||
Sequence: CPICLELLKEPVSADCNHSFCRACITLNYESNRNTDGKGNCPVCR | ||||||
Zinc finger | 91-132 | B box-type | ||||
Sequence: QKVNICAQHGEKLRLFCRKDMMVICWLCERSQEHRGHQTALI | ||||||
Coiled coil | 173-239 | |||||
Sequence: NQIQINVENVQRQFKGLRDLLDSKENEELQKLKKEKKEVMEKLEESENELEDQTELVRDLISDVEHH | ||||||
Region | 205-210 | Highly hydrophilic | ||||
Sequence: KKEKKE | ||||||
Motif | 268-276 | Nuclear localization signal | ||||
Sequence: TVPQKRKRT | ||||||
Domain | 281-496 | B30.2/SPRY | ||||
Sequence: DLKGMLQVYQGLMDIQQYWVHMTLHARNNAVIAINKEKRQIQYRSYNTVPVSEIYHLGVLGYPALSSGKHYWEVDISRSDAWLLGLNDGKCAQPQLHSKEEMGIKKNLHSQIKQNVLFQPKCGYWVIGMKNPSVYKAFDECSITHNSSILVISLPDRPSRVGVFLDRKAGTLSFYDVSNCGALIYRFYDPAFPVEVYPYFNPMKCSEPMTICGPPS |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P15533-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameAlpha
- Length496
- Mass (Da)57,330
- Last updated2002-02-11 v2
- Checksum66502B93BDC3A1D2
P15533-2
- NameBeta
Sequence caution
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 68 | in Ref. 7; AAH05447 | ||||
Sequence: R → K | ||||||
Alternative sequence | VSP_005762 | 145-151 | in isoform Beta | |||
Sequence: GALWKLM → SLHHTEL | ||||||
Sequence conflict | 148 | in Ref. 7; AAH05447 | ||||
Sequence: W → R | ||||||
Alternative sequence | VSP_005763 | 152-496 | in isoform Beta | |||
Sequence: Missing | ||||||
Sequence conflict | 241 | in Ref. 7; AAH05447 | ||||
Sequence: E → Q | ||||||
Sequence conflict | 268 | in Ref. 7; AAH05447 | ||||
Sequence: T → S | ||||||
Sequence conflict | 416 | in Ref. 7; AAH05447 | ||||
Sequence: K → N | ||||||
Sequence conflict | 437 | in Ref. 7; AAH05447 | ||||
Sequence: R → C |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
J03776 EMBL· GenBank· DDBJ | AAA40073.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AF220014 EMBL· GenBank· DDBJ | AAG53468.1 EMBL· GenBank· DDBJ | mRNA | ||
AF220015 EMBL· GenBank· DDBJ | AAG53469.1 EMBL· GenBank· DDBJ | mRNA | ||
AF220016 EMBL· GenBank· DDBJ | AAG53470.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
AK134144 EMBL· GenBank· DDBJ | BAE22032.1 EMBL· GenBank· DDBJ | mRNA | ||
AK137506 EMBL· GenBank· DDBJ | BAE23387.1 EMBL· GenBank· DDBJ | mRNA | ||
AC122400 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC142110 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH466531 EMBL· GenBank· DDBJ | EDL16725.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH466531 EMBL· GenBank· DDBJ | EDL16726.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC005447 EMBL· GenBank· DDBJ | AAH05447.1 EMBL· GenBank· DDBJ | mRNA |