P15490 · VSPA_SOYBN
- ProteinStem 28 kDa glycoprotein
- GeneVSPA
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids254 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
May function as somatic storage protein during early seedling development.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | nutrient reservoir activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameStem 28 kDa glycoprotein
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fabales > Fabaceae > Papilionoideae > 50 kb inversion clade > NPAAA clade > indigoferoid/millettioid clade > Phaseoleae > Glycine > Glycine subgen. Soja
Accessions
- Primary accessionP15490
Proteomes
Genome annotation databases
PTM/Processing
Features
Showing features for signal, propeptide, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MKMKVLVFFVATILVAWQCHA | ||||||
Propeptide | PRO_0000023989 | 22-34 | ||||
Sequence: YDMFPLRMNTGYG | ||||||
Chain | PRO_0000023990 | 35-254 | Stem 28 kDa glycoprotein | |||
Sequence: ARTPEVKCASWRLAVEAHNIFGFETIPEECVEATKEYIHGEQYRSDSKTVNQQAYFYARDLEVHPKDTFVFSIDGTVLSNIPYYKKHGYGVEKFNSTLYDEWVNKGNAPALPETLKNYNKLVSLGFKIIFLSGRTLDKQAVTEANLKKAGYHTWEKLILKDPQDPSTPNAVSYKTAAREKLIRQGYNIVGIIGDQWSDLLGGHRGESRTFKLPNPLYYIQ | ||||||
Glycosylation | 129 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Accumulates in the stems of developing soybean seedlings.
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length254
- Mass (Da)29,065
- Last updated1990-04-01 v1
- Checksum1B13F66054CEEF8B
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
K7KZ11 | K7KZ11_SOYBN | 547821 | 245 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M37530 EMBL· GenBank· DDBJ | AAA33937.1 EMBL· GenBank· DDBJ | mRNA | ||
M76981 EMBL· GenBank· DDBJ | AAA33967.1 EMBL· GenBank· DDBJ | Genomic DNA |