P15384 · KCNA3_RAT
- ProteinPotassium voltage-gated channel subfamily A member 3
- GeneKcna3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids525 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.
Catalytic activity
- K+(in) = K+(out)
Activity regulation
Activity is up-regulated by JAK2.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 228 | Not glycosylated | ||||
Sequence: N |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axon | |
Cellular Component | calyx of Held | |
Cellular Component | glutamatergic synapse | |
Cellular Component | membrane | |
Cellular Component | membrane raft | |
Cellular Component | plasma membrane | |
Cellular Component | postsynaptic membrane | |
Cellular Component | presynaptic membrane | |
Cellular Component | voltage-gated potassium channel complex | |
Molecular Function | delayed rectifier potassium channel activity | |
Molecular Function | outward rectifier potassium channel activity | |
Molecular Function | voltage-gated potassium channel activity | |
Biological Process | action potential | |
Biological Process | corpus callosum development | |
Biological Process | optic nerve development | |
Biological Process | potassium ion transmembrane transport | |
Biological Process | potassium ion transport | |
Biological Process | protein homooligomerization |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePotassium voltage-gated channel subfamily A member 3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionP15384
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-184 | Cytoplasmic | ||||
Sequence: MTVVPGDHLLEPEAAGGGGGDPPQGGCVSGGGCDRYEPLPPALPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPAR | ||||||
Transmembrane | 185-203 | Helical; Name=Segment S1 | ||||
Sequence: GIAIVSVLVILISIVIFCL | ||||||
Topological domain | 204-244 | Extracellular | ||||
Sequence: ETLPEFRDEKDYPASPSQDVFEAANNSTSGASSGASSFSDP | ||||||
Transmembrane | 245-266 | Helical; Name=Segment S2 | ||||
Sequence: FFVVETLCIIWFSFELLVRFFA | ||||||
Topological domain | 267-277 | Cytoplasmic | ||||
Sequence: CPSKATFSRNI | ||||||
Transmembrane | 278-298 | Helical; Name=Segment S3 | ||||
Sequence: MNLIDIVAIIPYFITLGTELA | ||||||
Topological domain | 299-312 | Extracellular | ||||
Sequence: ERQGNGQQAMSLAI | ||||||
Transmembrane | 313-331 | Helical; Voltage-sensor; Name=Segment S4 | ||||
Sequence: LRVIRLVRVFRIFKLSRHS | ||||||
Topological domain | 332-347 | Cytoplasmic | ||||
Sequence: KGLQILGQTLKASMRE | ||||||
Transmembrane | 348-367 | Helical; Name=Segment S5 | ||||
Sequence: LGLLIFFLFIGVILFSSAVY | ||||||
Topological domain | 368-408 | Extracellular | ||||
Sequence: FAEADDPSSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGK | ||||||
Transmembrane | 409-431 | Helical; Name=Segment S6 | ||||
Sequence: IVGSLCAIAGVLTIALPVPVIVS | ||||||
Topological domain | 432-525 | Cytoplasmic | ||||
Sequence: NFNYFYHRETEGEEQAQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV |
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 449 | Loss of phosphorylation. | ||||
Sequence: Y → F |
Chemistry
PTM/Processing
Features
Showing features for chain, glycosylation, lipidation, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000053979 | 1-525 | Potassium voltage-gated channel subfamily A member 3 | |||
Sequence: MTVVPGDHLLEPEAAGGGGGDPPQGGCVSGGGCDRYEPLPPALPAAGEQDCCGERVVINISGLRFETQLKTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIFSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVSVLVILISIVIFCLETLPEFRDEKDYPASPSQDVFEAANNSTSGASSGASSFSDPFFVVETLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADDPSSGFNSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEGEEQAQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV | ||||||
Glycosylation | 229 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Lipidation | 267 | S-palmitoyl cysteine | ||||
Sequence: C | ||||||
Modified residue | 449 | Phosphotyrosine | ||||
Sequence: Y | ||||||
Modified residue | 470 | Phosphoserine; by PKA | ||||
Sequence: S |
Post-translational modification
Phosphorylation on Tyr-449 inhibits its channel activity.
N-glycosylation promotes the cell surface expression.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Homotetramer. Forms heterooligomers with KCNE4 which inhibits KCNA3 activity by impairing localization to the cell membrane. The stoichiometry of KCNA3 and KCNE4 in the heterooligomers are 4:1, 4:2, 4:3 or 4:4 respectively. Increasing the number of KCNE4 subunits steadily slows the activation KCNA3 and decreases its abundance at the cell membrane. However, a single subunit of KCNE4 is sufficient for the cooperative enhancement of the inactivating function of the channel (PubMed:27802162, PubMed:19773357, PubMed:32370164).
Interacts with SEC24D; this interaction is reduced in the presence of KCNE4 (PubMed:27802162).
Interacts with DLG1, DLG2 and DLG4 via their PDZ domains (PubMed:7477295).
Interacts with SEC24D; this interaction is reduced in the presence of KCNE4 (PubMed:27802162).
Interacts with DLG1, DLG2 and DLG4 via their PDZ domains (PubMed:7477295).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
XENO | P15384 | DLG4 P78352 | 2 | EBI-631478, EBI-80389 |
Protein-protein interaction databases
Chemistry
Structure
Family & Domains
Features
Showing features for region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-23 | Disordered | ||||
Sequence: MTVVPGDHLLEPEAAGGGGGDPP | ||||||
Motif | 394-399 | Selectivity filter | ||||
Sequence: TVGYGD | ||||||
Region | 432-525 | Interaction with KCNE4 | ||||
Sequence: NFNYFYHRETEGEEQAQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV | ||||||
Motif | 523-525 | PDZ-binding | ||||
Sequence: TDV |
Domain
The N-terminus may be important in determining the rate of inactivation of the channel while the tail may play a role in modulation of channel activity and/or targeting of the channel to specific subcellular compartments.
The segment S4 is probably the voltage-sensor and is characterized by a series of positively charged amino acids at every third position.
Sequence similarities
Belongs to the potassium channel family. A (Shaker) (TC 1.A.1.2) subfamily. Kv1.3/KCNA3 sub-subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length525
- Mass (Da)58,425
- Last updated1990-11-01 v2
- Checksum6DA8869D5471C401
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 106 | in Ref. 1; CAA34132 | ||||
Sequence: F → L | ||||||
Sequence conflict | 181 | in Ref. 3; AAA42035 | ||||
Sequence: G → R | ||||||
Sequence conflict | 430 | in Ref. 3; AAA42035 | ||||
Sequence: V → L |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X16001 EMBL· GenBank· DDBJ | CAA34132.1 EMBL· GenBank· DDBJ | mRNA | ||
M30312 EMBL· GenBank· DDBJ | AAA42035.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M31744 EMBL· GenBank· DDBJ | AAA41500.1 EMBL· GenBank· DDBJ | Genomic DNA |