P15372 · ARRA_DROME
- ProteinPhosrestin-2
- GeneArr1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids364 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Regulates photoreceptor cell deactivation (PubMed:8316831).
Arr1 and Arr2 proteins are mediators of rhodopsin inactivation and are essential for the termination of the phototransduction cascade (PubMed:8316831).
Involved in regulating normal cycles of per nuclear accumulation in brain circadian neurons and thus is important for normal circadian behavior (PubMed:36994075).
In the dark, functions with Arr2 to promote the formation of cytosolic Bdbt foci, which are required for dco localization to photoreceptor nuclei where it phosphorylates and activates degradation of per (PubMed:36994075).
Arr1 and Arr2 proteins are mediators of rhodopsin inactivation and are essential for the termination of the phototransduction cascade (PubMed:8316831).
Involved in regulating normal cycles of per nuclear accumulation in brain circadian neurons and thus is important for normal circadian behavior (PubMed:36994075).
In the dark, functions with Arr2 to promote the formation of cytosolic Bdbt foci, which are required for dco localization to photoreceptor nuclei where it phosphorylates and activates degradation of per (PubMed:36994075).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | rhabdomere | |
Molecular Function | G protein-coupled receptor binding | |
Molecular Function | opsin binding | |
Biological Process | desensitization of G protein-coupled receptor signaling pathway | |
Biological Process | endocytosis | |
Biological Process | G protein-coupled receptor internalization | |
Biological Process | negative regulation of opsin-mediated signaling pathway | |
Biological Process | negative regulation of phospholipase C-activating phototransduction signaling pathway | |
Biological Process | photoreceptor cell maintenance | |
Biological Process | sensory perception of smell | |
Biological Process | signal transduction | |
Biological Process | visual perception |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePhosrestin-2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP15372
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000205215 | 1-364 | Phosrestin-2 | |||
Sequence: MVVNFKVFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDDEMIGLRFQKELTLVSQQVCPPQKQDIQLTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKASDESQPCGVQYFVKIFTGDSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSPGELELEVTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFMETSEGCPLNPGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDARDAFGIIVSYAVKVKLFLGALGGELCAELPFILMHPKPSRKAQLEAEGSIEA |
Post-translational modification
Phosphorylated, but does not undergo light-induced phosphorylation.
Keywords
- PTM
Proteomic databases
Expression
Tissue specificity
Expressed specifically and abundantly in photoreceptor cells in retina and ocelli.
Developmental stage
Accumulates to detectable levels by late pupation at 8 days reaching maximum levels after eclosion at 10 days.
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length364
- Mass (Da)40,771
- Last updated1990-04-01 v1
- Checksum0DCC764C4F890FC2
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M30177 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
M30140 EMBL· GenBank· DDBJ | AAA28380.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014134 EMBL· GenBank· DDBJ | AAF53644.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY061824 EMBL· GenBank· DDBJ | AAL27635.1 EMBL· GenBank· DDBJ | mRNA |