P13797 · PLST_HUMAN
- ProteinPlastin-3
- GenePLS3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids630 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Actin-bundling protein.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 25 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 27 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 29 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 36 | Ca2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 65 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 67 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 69 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 71 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 76 | Ca2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | actin filament | |
Cellular Component | actin filament bundle | |
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | plasma membrane | |
Molecular Function | actin filament binding | |
Molecular Function | calcium ion binding | |
Biological Process | actin filament bundle assembly | |
Biological Process | actin filament network formation | |
Biological Process | bone development |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePlastin-3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP13797
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Osteoporosis (OSTEOP)
- Note
- DescriptionA systemic skeletal disorder characterized by decreased bone mass and deterioration of bone microarchitecture without alteration in the composition of bone. The result is fragile bones and an increased risk of fractures, even after minimal trauma. Osteoporosis is a chronic condition of multifactorial etiology and is usually clinically silent until a fracture occurs.
- See alsoMIM:166710
Natural variants in OSTEOP
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_070278 | 253 | A>AN | in OSTEOP; uncertain significance; no effect on protein level in patient's fibroblasts | |
VAR_089134 | 491-630 | missing | in OSTEOP; uncertain significance |
Diaphragmatic hernia 5, X-linked (DIH5)
- Note
- DescriptionA form of congenital diaphragmatic hernia, a posterolateral defect of the diaphragm, generally located on the left side, that permits the herniation of abdominal viscera into the thorax. The lungs are hypoplastic and have abnormal vessels that cause respiratory insufficiency and persistent pulmonary hypertension with high mortality. About one third of cases have cardiovascular malformations and lesser proportions have skeletal, neural, genitourinary, gastrointestinal or other defects. DIH5 is usually transmitted in an X-linked recessive pattern with males being severely affected. Early death is frequent.
- See alsoMIM:306950
Natural variants in DIH5
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_089124 | 120 | S>F | in DIH5; uncertain significance | |
VAR_089125 | 206 | A>V | in DIH5; likely pathogenic | |
VAR_089127 | 235 | I>V | in DIH5; uncertain significance | |
VAR_089129 | 270 | E>K | in DIH5; likely pathogenic | |
VAR_089130 | 352 | F>L | in DIH5; uncertain significance | |
VAR_089131 | 364 | K>E | in DIH5; uncertain significance | |
VAR_089135 | 499 | W>C | in DIH5; likely pathogenic; the orthologous mutation in mice results in death within the first 2 days after birth; the animals display several phenotypes at late gestation and neonatal time points, including diaphragm abnormalities and anterior body-wall defects | |
VAR_089136 | 592 | M>V | in DIH5; uncertain significance |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_089124 | 120 | in DIH5; uncertain significance | |||
Sequence: S → F | ||||||
Natural variant | VAR_089125 | 206 | in DIH5; likely pathogenic | |||
Sequence: A → V | ||||||
Natural variant | VAR_089126 | 229 | found in a patient with X-linked osteogenesis imperfecta; uncertain significance | |||
Sequence: G → R | ||||||
Natural variant | VAR_089127 | 235 | in DIH5; uncertain significance | |||
Sequence: I → V | ||||||
Natural variant | VAR_070278 | 253 | in OSTEOP; uncertain significance; no effect on protein level in patient's fibroblasts | |||
Sequence: A → AN | ||||||
Natural variant | VAR_089128 | 256-630 | found in a patient with childhood-onset primary osteoporosis; likely pathogenic | |||
Sequence: Missing | ||||||
Natural variant | VAR_089129 | 270 | in DIH5; likely pathogenic | |||
Sequence: E → K | ||||||
Natural variant | VAR_089130 | 352 | in DIH5; uncertain significance | |||
Sequence: F → L | ||||||
Natural variant | VAR_089131 | 364 | in DIH5; uncertain significance | |||
Sequence: K → E | ||||||
Natural variant | VAR_089132 | 446 | found in a patient with childhood-onset primary osteoporosis; uncertain significance | |||
Sequence: N → S | ||||||
Natural variant | VAR_089133 | 478 | found in a patient with childhood-onset primary osteoporosis; uncertain significance | |||
Sequence: L → P | ||||||
Natural variant | VAR_035462 | 488 | in a breast cancer sample; somatic mutation | |||
Sequence: D → A | ||||||
Natural variant | VAR_089134 | 491-630 | in OSTEOP; uncertain significance | |||
Sequence: Missing | ||||||
Natural variant | VAR_089135 | 499 | in DIH5; likely pathogenic; the orthologous mutation in mice results in death within the first 2 days after birth; the animals display several phenotypes at late gestation and neonatal time points, including diaphragm abnormalities and anterior body-wall defects | |||
Sequence: W → C | ||||||
Natural variant | VAR_089136 | 592 | in DIH5; uncertain significance | |||
Sequence: M → V |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 496 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000073747 | 1-630 | UniProt | Plastin-3 | |||
Sequence: MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKLMLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV | |||||||
Modified residue (large scale data) | 120 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 127 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue | 268 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 293 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 293 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 326 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 326 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 339 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 339 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 391 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 391 | PRIDE | Phosphothreonine | ||||
Sequence: T |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in a variety of organs, including muscle, brain, uterus and esophagus.
Gene expression databases
Organism-specific databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 12-47 | EF-hand 1 | ||||
Sequence: DELDELKEAFAKVDLNSNGFICDYELHELFKEANMP | ||||||
Domain | 52-87 | EF-hand 2 | ||||
Sequence: KVREIIQKLMLDGDRNKDGKISFDEFVYIFQEVKSS | ||||||
Region | 109-382 | Actin-binding 1 | ||||
Sequence: TSELSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPALTK | ||||||
Domain | 123-239 | Calponin-homology (CH) 1 | ||||
Sequence: EEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGL | ||||||
Domain | 267-378 | Calponin-homology (CH) 2 | ||||
Sequence: LSPEELLLRWANFHLENSGWQKINNFSADIKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYP | ||||||
Region | 383-627 | Actin-binding 2 | ||||
Sequence: PENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGM | ||||||
Domain | 397-506 | Calponin-homology (CH) 3 | ||||
Sequence: TREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYT | ||||||
Domain | 518-627 | Calponin-homology (CH) 4 | ||||
Sequence: KANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGM |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
P13797-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length630
- Mass (Da)70,811
- Last updated2009-04-14 v4
- Checksum631E6F803DC56A56
P13797-2
- Name2
P13797-3
- Name3
- Differences from canonical
- 1-45: Missing
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Features
Showing features for alternative sequence.
Polymorphism
Genetic variations in PLS3 define the bone mineral density quantitative trait locus 18 (BMND18) [MIM:300910]. Variance in bone mineral density influences bone mass, contributes to size determination in the general population, and is a susceptibility factor for osteoporotic fractures.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M22299 EMBL· GenBank· DDBJ | AAB02844.1 EMBL· GenBank· DDBJ | mRNA | ||
M34427 EMBL· GenBank· DDBJ | AAA36759.1 EMBL· GenBank· DDBJ | mRNA | ||
AK291194 EMBL· GenBank· DDBJ | BAF83883.1 EMBL· GenBank· DDBJ | mRNA | ||
AK294509 EMBL· GenBank· DDBJ | BAG57725.1 EMBL· GenBank· DDBJ | mRNA | ||
AK300575 EMBL· GenBank· DDBJ | BAH13307.1 EMBL· GenBank· DDBJ | mRNA | ||
AK312391 EMBL· GenBank· DDBJ | BAG35308.1 EMBL· GenBank· DDBJ | mRNA | ||
AC003983 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC005000 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL589842 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471120 EMBL· GenBank· DDBJ | EAX02614.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC039049 EMBL· GenBank· DDBJ | AAH39049.1 EMBL· GenBank· DDBJ | mRNA | ||
BC056898 EMBL· GenBank· DDBJ | AAH56898.1 EMBL· GenBank· DDBJ | mRNA | ||
L05491 EMBL· GenBank· DDBJ | AAA61214.1 EMBL· GenBank· DDBJ | Genomic DNA |