P13378 · HXD8_HUMAN
- ProteinHomeobox protein Hox-D8
- GeneHOXD8
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids290 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 197-256 | Homeobox | ||||
Sequence: RRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKEN |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription activator activity, RNA polymerase II-specific | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | RNA polymerase II transcription regulatory region sequence-specific DNA binding | |
Molecular Function | sequence-specific double-stranded DNA binding | |
Biological Process | anterior/posterior axis specification, embryo | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | skeletal system morphogenesis |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHomeobox protein Hox-D8
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP13378
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 446 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000200216 | 1-290 | Homeobox protein Hox-D8 | |||
Sequence: MSSYFVNPLYSKYKAAAAAAAAAGEAINPTYYDCHFAPEVGGRHAAAAAALQLYGNSAAGFPHAPPQAHAHPHPSPPPSGTGCGGREGRGQEYFHPGGGSPAAAYQAAPPPPPHPPPPPPPPPCGGIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQELEEDRAEGLTN |
Proteomic databases
PTM databases
Expression
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P13378 | BAIAP2 Q9UQB8-6 | 3 | EBI-7098661, EBI-9092016 | |
BINARY | P13378 | LDLRAP1 Q5SW96 | 3 | EBI-7098661, EBI-747813 | |
BINARY | P13378 | NCK2 O43639 | 3 | EBI-7098661, EBI-713635 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 60-127 | Disordered | ||||
Sequence: GFPHAPPQAHAHPHPSPPPSGTGCGGREGRGQEYFHPGGGSPAAAYQAAPPPPPHPPPPPPPPPCGGI | ||||||
Compositional bias | 105-127 | Pro residues | ||||
Sequence: YQAAPPPPPHPPPPPPPPPCGGI | ||||||
Compositional bias | 161-187 | Polar residues | ||||
Sequence: DCKSSSGNIGEDPDHLNQSSSPSQMFP | ||||||
Region | 161-200 | Disordered | ||||
Sequence: DCKSSSGNIGEDPDHLNQSSSPSQMFPWMRPQAAPGRRRG | ||||||
Region | 255-290 | Disordered | ||||
Sequence: ENNKDKFPVSRQEVKDGETKKEAQELEEDRAEGLTN |
Sequence similarities
Belongs to the Antp homeobox family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
P13378-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length290
- Mass (Da)31,911
- Last updated2001-02-21 v2
- Checksum75FF95A73E2AA85F
P13378-2
- Name2
- Differences from canonical
- 193-193: Missing
P13378-3
- Name3
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0A0MSX5 | A0A0A0MSX5_HUMAN | HOXD8 | 106 | ||
A0A0A0MTF4 | A0A0A0MTF4_HUMAN | HOXD8 | 186 |
Features
Showing features for alternative sequence, sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_045862 | 1-184 | in isoform 3 | |||
Sequence: Missing | ||||||
Sequence conflict | 39 | in Ref. 4; AAH90853 | ||||
Sequence: E → G | ||||||
Compositional bias | 105-127 | Pro residues | ||||
Sequence: YQAAPPPPPHPPPPPPPPPCGGI | ||||||
Compositional bias | 161-187 | Polar residues | ||||
Sequence: DCKSSSGNIGEDPDHLNQSSSPSQMFP | ||||||
Alternative sequence | VSP_042856 | 193 | in isoform 2 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_045863 | 252-290 | in isoform 3 | |||
Sequence: Missing | ||||||
Sequence conflict | 287 | in Ref. 5; CAA33529 | ||||
Sequence: G → A |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY014304 EMBL· GenBank· DDBJ | AAG42152.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY014303 EMBL· GenBank· DDBJ | AAG42152.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL520835 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
AC009336 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC038709 EMBL· GenBank· DDBJ | AAH38709.1 EMBL· GenBank· DDBJ | mRNA | ||
BC090853 EMBL· GenBank· DDBJ | AAH90853.1 EMBL· GenBank· DDBJ | mRNA | ||
X15507 EMBL· GenBank· DDBJ | CAA33529.1 EMBL· GenBank· DDBJ | Genomic DNA |