P13199 · ICP27_SHV21
- ProteinmRNA export factor ICP27 homolog
- GeneEJRF1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids417 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Probably acts as a viral splicing factor that regulates viral RNA splicing. Functions as a multifunctional regulator of the expression of viral lytic genes (By similarity).
Early protein that promotes the accumulation and nuclear export of viral intronless RNA transcripts by interacting with mRNAs and cellular export proteins
Early protein that promotes the accumulation and nuclear export of viral intronless RNA transcripts by interacting with mRNAs and cellular export proteins
Miscellaneous
ORF50 and ORF57 are the earliest genes expressed in the lytic cycle.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell cytoplasm | |
Cellular Component | host cell nucleus | |
Molecular Function | metal ion binding | |
Molecular Function | molecular adaptor activity | |
Molecular Function | RNA binding | |
Biological Process | regulation of DNA-templated transcription |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended namemRNA export factor ICP27 homolog
- Alternative names
Gene names
Organism names
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Peploviricota > Herviviricetes > Herpesvirales > Orthoherpesviridae > Gammaherpesvirinae > Rhadinovirus > Rhadinovirus saimiriinegamma2 > Saimiriine herpesvirus 2
- Virus hosts
Accessions
- Primary accessionP13199
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Shuttles between the nucleus and the cytoplasm.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000115832 | 1-417 | mRNA export factor ICP27 homolog | |||
Sequence: MEDIIEGGISSDDDFDSSDSSSDEEESDTSPQIMKSDVTMASPPSTPEPSPDVSASTSNLKRERQRSPITWEHQSPLSRVYRSPSPMRFGKRPRISSNSTSRSCKTSWADRVREAAAQRRPSRPFRKPYSHPRNGPLRNGPPRAPPLLKLFDISILPKSGEPKLFLPVPSLPCQEAEKTNDKYVLAMAQRAMHDVPISSKQLTANLLPVKFKPLLSIVRYTPNYYYWVSMRKETIASANLCTVAAFLDESLCWGQQYLKNDFIFSENGKDIILDTSSALLSQLVHKIKMLPFCHCLMQTTPQDHIVKQVCYLIASNNRILDAVRYLQTSVIKSPIVLLLAYAVCLPAAIICTKNETQLYSHCMRILKEYRPGDVMNILHESLTQHLNKCPSSTCAYTTRAIVGTKANTTGLFFLPTQ |
Expression
Induction
Transactivated by ORF50 protein.
Keywords
- Developmental stage
Interaction
Subunit
Homodimer. Homodimerization is required for transactivation (By similarity).
Interacts with host ALYREF and with mouse ALYREF2. Associates in a complex with RNA, and host export factors NXF1/TAP and ALYREF or ALYREF2; these interactions allow nuclear export of viral transcripts
Interacts with host ALYREF and with mouse ALYREF2. Associates in a complex with RNA, and host export factors NXF1/TAP and ALYREF or ALYREF2; these interactions allow nuclear export of viral transcripts
Family & Domains
Features
Showing features for compositional bias, region, motif, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-26 | Acidic residues | ||||
Sequence: MEDIIEGGISSDDDFDSSDSSSDEEE | ||||||
Region | 1-143 | Disordered | ||||
Sequence: MEDIIEGGISSDDDFDSSDSSSDEEESDTSPQIMKSDVTMASPPSTPEPSPDVSASTSNLKRERQRSPITWEHQSPLSRVYRSPSPMRFGKRPRISSNSTSRSCKTSWADRVREAAAQRRPSRPFRKPYSHPRNGPLRNGPPR | ||||||
Compositional bias | 51-81 | Polar residues | ||||
Sequence: PDVSASTSNLKRERQRSPITWEHQSPLSRVY | ||||||
Region | 64-120 | Interaction with RNA | ||||
Sequence: RQRSPITWEHQSPLSRVYRSPSPMRFGKRPRISSNSTSRSCKTSWADRVREAAAQRR | ||||||
Motif | 88-94 | Nuclear localization signal | ||||
Sequence: RFGKRPR | ||||||
Compositional bias | 92-106 | Polar residues | ||||
Sequence: RPRISSNSTSRSCKT | ||||||
Region | 106-120 | Interaction with host ALYREF or mouse ALYREF2 | ||||
Sequence: TSWADRVREAAAQRR | ||||||
Compositional bias | 107-121 | Basic and acidic residues | ||||
Sequence: SWADRVREAAAQRRP | ||||||
Motif | 118-127 | Nuclear localization signal | ||||
Sequence: QRRPSRPFRK | ||||||
Zinc finger | 295-394 | CHC2-type | ||||
Sequence: CLMQTTPQDHIVKQVCYLIASNNRILDAVRYLQTSVIKSPIVLLLAYAVCLPAAIICTKNETQLYSHCMRILKEYRPGDVMNILHESLTQHLNKCPSSTC |
Domain
Binds viral intronless RNAs; the RNA binding site overlaps partially with the binding site for host ALYREF or ALYREF2.
Sequence similarities
Belongs to the HHV-1 ICP27 protein family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length417
- Mass (Da)46,816
- Last updated1993-04-01 v2
- Checksum12F0EA3733F00940
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-26 | Acidic residues | ||||
Sequence: MEDIIEGGISSDDDFDSSDSSSDEEE | ||||||
Compositional bias | 51-81 | Polar residues | ||||
Sequence: PDVSASTSNLKRERQRSPITWEHQSPLSRVY | ||||||
Compositional bias | 92-106 | Polar residues | ||||
Sequence: RPRISSNSTSRSCKT | ||||||
Compositional bias | 107-121 | Basic and acidic residues | ||||
Sequence: SWADRVREAAAQRRP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X64346 EMBL· GenBank· DDBJ | CAA45680.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M86409 EMBL· GenBank· DDBJ | AAA46125.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
M21943 EMBL· GenBank· DDBJ | AAA66558.1 EMBL· GenBank· DDBJ | Genomic DNA |