P12858 · G3PA_PEA
- ProteinGlyceraldehyde-3-phosphate dehydrogenase A, chloroplastic
- GeneGAPA
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids405 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
Miscellaneous
Plants contain two types of GAPDH: cytosolic forms which participate in glycolysis and chloroplast forms which participate in photosynthesis. All the forms are encoded by distinct genes.
Catalytic activity
- D-glyceraldehyde 3-phosphate + NADP+ + phosphate = (2R)-3-phospho-glyceroyl phosphate + H+ + NADPH
Pathway
Carbohydrate biosynthesis; Calvin cycle.
Features
Showing features for binding site, active site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 80-81 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: RI | ||||||
Binding site | 104 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 149 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 221-223 | D-glyceraldehyde 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: SCT | ||||||
Active site | 222 | Nucleophile | ||||
Sequence: C | ||||||
Site | 249 | Activates thiol group during catalysis | ||||
Sequence: H | ||||||
Binding site | 252 | D-glyceraldehyde 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 267 | D-glyceraldehyde 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 280-281 | D-glyceraldehyde 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: TG | ||||||
Binding site | 303 | D-glyceraldehyde 3-phosphate (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 385 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: N |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Molecular Function | glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) activity | |
Molecular Function | NAD binding | |
Molecular Function | NADP binding | |
Biological Process | glucose metabolic process | |
Biological Process | reductive pentose-phosphate cycle |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlyceraldehyde-3-phosphate dehydrogenase A, chloroplastic
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fabales > Fabaceae > Papilionoideae > 50 kb inversion clade > NPAAA clade > Hologalegina > IRL clade > Fabeae > Pisum
Accessions
- Primary accessionP12858
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-68 | Chloroplast | ||||
Sequence: MASATFSVAKPAIKANGKGFSEFSGLRNSSRHLPFSRKSSDDFHSLVTFQTNAVGSSGGHKKSLVVEA | ||||||
Chain | PRO_0000010423 | 69-405 | Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic | |||
Sequence: KQLKVAINGFGRIGRNFLRCWHGRKDSPLDVIAINDTGGVKQASHLLKYDSTLGIFDADVKPVGTDGISVDGKVIKVVSDRNPANLPWKELGIDLVIEGTGVFVDREGAGRHITAGAKKVLITAPGKGDIPTYVVGVNADAYTHADDIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPTLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNEAFRESAAKELTGILSVCDEPLVSVDFRCTDVSSTVDSSLTMVMGDDLVKVIAWYDNEWGYSQRVVDLADIVANNWK |
Interaction
Subunit
Tetramer of either four A chains (GAPDH 2) or two A and two B chains (GAPDH 1).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P12858 | GAPB P12859 | 2 | EBI-15689968, EBI-15689988 |
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length405
- Mass (Da)43,338
- Last updated1992-05-01 v2
- Checksum667FD75FD3EA6430
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 194 | in Ref. 2; CAA33264 | ||||
Sequence: G → R |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X52148 EMBL· GenBank· DDBJ | CAA36396.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X15190 EMBL· GenBank· DDBJ | CAA33264.1 EMBL· GenBank· DDBJ | mRNA |