P12850 · GROA_MOUSE
- ProteinGrowth-regulated alpha protein
- GeneCxcl1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation (By similarity).
Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. KC(5-72) shows a highly enhanced hematopoietic activity
Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. KC(5-72) shows a highly enhanced hematopoietic activity
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Molecular Function | chemokine activity | |
Molecular Function | CXCR chemokine receptor binding | |
Molecular Function | growth factor activity | |
Biological Process | antimicrobial humoral immune response mediated by antimicrobial peptide | |
Biological Process | cellular response to interleukin-17 | |
Biological Process | cellular response to lipopolysaccharide | |
Biological Process | chemokine-mediated signaling pathway | |
Biological Process | inflammatory response | |
Biological Process | neutrophil chemotaxis | |
Biological Process | positive regulation of cytosolic calcium ion concentration | |
Biological Process | positive regulation of hematopoietic stem cell proliferation | |
Biological Process | positive regulation of neutrophil mediated killing of fungus | |
Biological Process | positive regulation of potassium ion transport | |
Biological Process | positive regulation of sodium ion transport | |
Biological Process | positive regulation of superoxide anion generation |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGrowth-regulated alpha protein
- Alternative names
- Cleaved into 1 chains
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP12850
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-24 | |||||
Sequence: MIPATRSLLCAALLLLATSRLATG | ||||||
Chain | PRO_0000005053 | 25-96 | Growth-regulated alpha protein | |||
Sequence: APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK | ||||||
Chain | PRO_0000005054 | 29-96 | KC(5-72) | |||
Sequence: NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK | ||||||
Disulfide bond | 33↔59 | |||||
Sequence: CQCLQTMAGIHLKNIQSLKVLPSGPHC | ||||||
Disulfide bond | 35↔75 | |||||
Sequence: CLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREAC |
Post-translational modification
The N-terminal processed form KC(5-72) is produced by proteolytic cleavage after secretion from bone marrow stromal cells.
Keywords
- PTM
Proteomic databases
Expression
Induction
By platelet-derived growth factor. In lung, by lipopolysaccharide or inflammation (By similarity).
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length96
- Mass (Da)10,254
- Last updated1989-10-01 v1
- Checksum4A52B5E5C38B45C2
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
J04596 EMBL· GenBank· DDBJ | AAA40131.1 EMBL· GenBank· DDBJ | mRNA | ||
U20634 EMBL· GenBank· DDBJ | AAB03376.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U20527 EMBL· GenBank· DDBJ | AAB03376.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S79767 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |