P12710 · FABPL_MOUSE
- ProteinFatty acid-binding protein, liver
- GeneFabp1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids127 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes. Binds cholesterol. Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apical cortex | |
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | peroxisomal matrix | |
Cellular Component | protein-containing complex | |
Molecular Function | antioxidant activity | |
Molecular Function | bile acid binding | |
Molecular Function | chromatin binding | |
Molecular Function | fatty acid binding | |
Molecular Function | heterocyclic compound binding | |
Molecular Function | long-chain fatty acid transmembrane transporter activity | |
Molecular Function | oleic acid binding | |
Molecular Function | phospholipid binding | |
Biological Process | cellular response to hydrogen peroxide | |
Biological Process | cellular response to hypoxia | |
Biological Process | fatty acid transport | |
Biological Process | intestinal absorption | |
Biological Process | long-chain fatty acid transport | |
Biological Process | negative regulation of apoptotic process | |
Biological Process | positive regulation of fatty acid beta-oxidation | |
Biological Process | response to vitamin B3 |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameFatty acid-binding protein, liver
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP12710
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 6 variants from UniProt as well as other sources including ClinVar and dbSNP.
Chemistry
PTM/Processing
Features
Showing features for modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 1 | N-acetylmethionine | ||||
Sequence: M | ||||||
Chain | PRO_0000067335 | 1-127 | Fatty acid-binding protein, liver | |||
Sequence: MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI | ||||||
Modified residue | 11 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 31 | N6-succinyllysine | ||||
Sequence: K | ||||||
Modified residue | 36 | N6-succinyllysine | ||||
Sequence: K | ||||||
Modified residue | 39 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 46 | N6-succinyllysine | ||||
Sequence: K | ||||||
Modified residue | 51 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 57 | N6-succinyllysine | ||||
Sequence: K | ||||||
Modified residue | 78 | N6-succinyllysine | ||||
Sequence: K | ||||||
Modified residue | 84 | N6-acetyllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 84 | N6-succinyllysine; alternate | ||||
Sequence: K | ||||||
Modified residue | 90 | N6-succinyllysine | ||||
Sequence: K | ||||||
Modified residue | 100 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 121 | N6-succinyllysine | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Domain
Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
Sequence similarities
Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length127
- Mass (Da)14,246
- Last updated1998-12-15 v2
- Checksum2C787139174DD24D
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Y14660 EMBL· GenBank· DDBJ | CAA74989.1 EMBL· GenBank· DDBJ | mRNA | ||
BC009812 EMBL· GenBank· DDBJ | AAH09812.1 EMBL· GenBank· DDBJ | mRNA |