P12208 · CLPP_MARPO
- ProteinATP-dependent Clp protease proteolytic subunit
- GeneclpP
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids203 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.
Catalytic activity
- Hydrolysis of proteins to small peptides in the presence of ATP and magnesium. alpha-casein is the usual test substrate. In the absence of ATP, only oligopeptides shorter than five residues are hydrolyzed (such as succinyl-Leu-Tyr-|-NHMec, and Leu-Tyr-Leu-|-Tyr-Trp, in which cleavage of the -Tyr-|-Leu- and -Tyr-|-Trp bonds also occurs).
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 101 | Nucleophile | ||||
Sequence: S | ||||||
Active site | 126 | |||||
Sequence: H |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid | |
Cellular Component | chloroplastic endopeptidase Clp complex | |
Molecular Function | ATP-dependent peptidase activity | |
Molecular Function | serine-type endopeptidase activity | |
Biological Process | proteolysis |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameATP-dependent Clp protease proteolytic subunit
- EC number
- Alternative names
Gene names
Encoded on
- Chloroplast
Organism names
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Marchantiophyta > Marchantiopsida > Marchantiidae > Marchantiales > Marchantiaceae > Marchantia
Accessions
- Primary accessionP12208
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000179744 | 1-203 | ATP-dependent Clp protease proteolytic subunit | |||
Sequence: MPIGVPKVPFRLPGEEDAVWIDVYNRLYRERLLFLGQQVDDEIANQLIGIMMYLNGEDESKDMYLYINSPGGAVLAGISVYDAMQFVVPDVHTICMGLAASMGSFILTGGEITKRIALPHARVMIHQPASSYYDGQAGECIMEAEEVLKLRDCITKVYVQRTGKPLWVISEDMERDVFMSAKEAKLYGIVDLVAIENNSTIKN |
Interaction
Subunit
Component of the chloroplastic Clp protease core complex.
Structure
Sequence
- Sequence statusComplete
- Length203
- Mass (Da)22,685
- Last updated1989-10-01 v1
- ChecksumC0C30114F13CB89B
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 184 | in Ref. 3 | ||||
Sequence: A → E |
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X04465 EMBL· GenBank· DDBJ | CAA28109.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X03661 EMBL· GenBank· DDBJ | CAA27296.1 EMBL· GenBank· DDBJ | Genomic DNA |