P12034 · FGF5_HUMAN
- ProteinFibroblast growth factor 5
- GeneFGF5
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids268 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | extracellular region | |
Cellular Component | extracellular space | |
Molecular Function | fibroblast growth factor receptor binding | |
Molecular Function | growth factor activity | |
Biological Process | animal organ morphogenesis | |
Biological Process | cell differentiation | |
Biological Process | cell-cell signaling | |
Biological Process | fibroblast growth factor receptor signaling pathway | |
Biological Process | glial cell differentiation | |
Biological Process | nervous system development | |
Biological Process | positive regulation of cell division | |
Biological Process | positive regulation of cell population proliferation | |
Biological Process | positive regulation of gene expression | |
Biological Process | positive regulation of MAPK cascade | |
Biological Process | positive regulation of protein phosphorylation | |
Biological Process | regulation of cell migration | |
Biological Process | signal transduction involved in regulation of gene expression |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameFibroblast growth factor 5
- Short namesFGF-5
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP12034
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Trichomegaly (TCMGLY)
- Note
- DescriptionA morphologic trait characterized by unusually long eyelashes and mild hypertrichosis of eyebrows. It can be observed in association with corneal irritation, cataracts, and hereditary spherocytosis.
- See alsoMIM:190330
Natural variants in TCMGLY
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_072566 | 174 | Y>H | in TCMGLY; dbSNP:rs587777581 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_025174 | 54 | in dbSNP:rs33950145 | |||
Sequence: M → V | ||||||
Natural variant | VAR_072566 | 174 | in TCMGLY; dbSNP:rs587777581 | |||
Sequence: Y → H |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 387 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MSLSFLLLLFFSHLILSAWA | ||||||
Chain | PRO_0000008958 | 21-268 | Fibroblast growth factor 5 | |||
Sequence: HGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG | ||||||
Glycosylation | 110 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in neonatal brain.
Developmental stage
Can transform NIH 3T3 cells.
Gene expression databases
Organism-specific databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 26-81 | Disordered | ||||
Sequence: LAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQW | ||||||
Compositional bias | 38-81 | Polar residues | ||||
Sequence: DRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQW | ||||||
Region | 233-255 | Disordered | ||||
Sequence: VPEKKKPPSPIKPKIPLSAPRKN |
Sequence similarities
Belongs to the heparin-binding growth factors family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
P12034-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameLong
- Length268
- Mass (Da)29,551
- Last updated2006-01-24 v4
- Checksum28B7268B26781BCF
P12034-2
- NameShort
- SynonymsFGF-5S
- NoteSeems to have an antagonistic effect compared to that of the isoform Long.
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
H0Y9E2 | H0Y9E2_HUMAN | FGF5 | 119 |
Sequence caution
Features
Showing features for compositional bias, sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 38-81 | Polar residues | ||||
Sequence: DRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQW | ||||||
Sequence conflict | 42 | in Ref. 1; AAB06463 | ||||
Sequence: R → I | ||||||
Sequence conflict | 83-86 | in Ref. 2; AAB60699 | ||||
Sequence: PSGR → LGA | ||||||
Alternative sequence | VSP_001518 | 120-123 | in isoform Short | |||
Sequence: VLEI → QVHR | ||||||
Alternative sequence | VSP_001519 | 124-268 | in isoform Short | |||
Sequence: Missing | ||||||
Sequence conflict | 224 | in Ref. 6; AAZ67914 | ||||
Sequence: Q → QQ | ||||||
Sequence conflict | 238 | in Ref. 1; AAB06463 and 2; AAB60699 | ||||
Sequence: K → N | ||||||
Sequence conflict | 245 | in Ref. 1; AAB06463 and 2; AAB60699 | ||||
Sequence: P → S |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M37825 EMBL· GenBank· DDBJ | AAB06463.1 EMBL· GenBank· DDBJ | mRNA | ||
M23536 EMBL· GenBank· DDBJ | AAB60699.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M23534 EMBL· GenBank· DDBJ | AAB60699.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M23535 EMBL· GenBank· DDBJ | AAB60699.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M23534 EMBL· GenBank· DDBJ | AAB60698.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AB016517 EMBL· GenBank· DDBJ | BAA33738.1 EMBL· GenBank· DDBJ | mRNA | ||
AF171928 EMBL· GenBank· DDBJ | AAF89742.1 EMBL· GenBank· DDBJ | mRNA | ||
AF535149 EMBL· GenBank· DDBJ | AAN04097.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ151636 EMBL· GenBank· DDBJ | AAZ67914.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK291962 EMBL· GenBank· DDBJ | BAF84651.1 EMBL· GenBank· DDBJ | mRNA | ||
AK312065 EMBL· GenBank· DDBJ | BAG35001.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471057 EMBL· GenBank· DDBJ | EAX05859.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471057 EMBL· GenBank· DDBJ | EAX05860.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC074858 EMBL· GenBank· DDBJ | AAH74858.1 EMBL· GenBank· DDBJ | mRNA | ||
BC074859 EMBL· GenBank· DDBJ | AAH74859.1 EMBL· GenBank· DDBJ | mRNA | ||
BC131502 EMBL· GenBank· DDBJ | AAI31503.1 EMBL· GenBank· DDBJ | mRNA |