P11985 · DYLT2_MOUSE
- ProteinDynein light chain Tctex-type protein 2
- GeneDynlt2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids191 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May be an accessory component of axonemal dynein and cytoplasmic dynein 1. Candidate for involvement in male sterility.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytoplasmic dynein complex | |
Cellular Component | cytosol | |
Cellular Component | membrane | |
Cellular Component | microtubule | |
Cellular Component | sperm flagellum | |
Molecular Function | dynein intermediate chain binding | |
Biological Process | microtubule-based movement |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDynein light chain Tctex-type protein 2
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP11985
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Peripheral membrane protein
Note: Found on the surface of sperm tail. Stored in cytoplasmic granules during spermatogenesis.
Keywords
- Cellular component
Phenotypes & Variants
Involvement in disease
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 17 | in T-haplotype | ||||
Sequence: Q → E | ||||||
Natural variant | 23 | in T-haplotype | ||||
Sequence: R → S | ||||||
Natural variant | 26 | in T-haplotype | ||||
Sequence: K → R | ||||||
Natural variant | 41-43 | in T-haplotype | ||||
Sequence: ERL → P | ||||||
Natural variant | 48 | in T-haplotype | ||||
Sequence: H → R | ||||||
Natural variant | 52 | in T-haplotype | ||||
Sequence: Y → F | ||||||
Natural variant | 60 | in T-haplotype | ||||
Sequence: S → A | ||||||
Natural variant | 64 | in T-haplotype; requires 2 nucleotide substitutions | ||||
Sequence: V → S | ||||||
Natural variant | 93 | in T-haplotype | ||||
Sequence: L → S | ||||||
Natural variant | 125 | in T-haplotype | ||||
Sequence: G → R | ||||||
Natural variant | 153 | in T-haplotype | ||||
Sequence: A → G |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 18 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000072471 | 1-191 | Dynein light chain Tctex-type protein 2 | |||
Sequence: MERRGRMAKTPTGQTHQSPVSKRERKPSMFEKESYAQILRERLRESFHDVQYVEPPFDDSIADVGKEWKSALAKLKFANSYRMEPLKKFQAHLVETKIQQILKDSLKDVKYDDKAPHLSLELADGILAAVKEFAYHRYKFIIQVLFIQKTGQAINIASRWIWDVAWDNWVEAKHETESYVVLALVFALYCE |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in testis (at protein level). Expressed at the pachyten stage of the first meiotic division and in later haploid spermatogenic stages.
Gene expression databases
Interaction
Subunit
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P11985-2 | Csnk2b P67871 | 2 | EBI-1781298, EBI-348179 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-29 | Disordered | ||||
Sequence: MERRGRMAKTPTGQTHQSPVSKRERKPSM |
Sequence similarities
Belongs to the dynein light chain Tctex-type family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P11985-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsLong
- Length191
- Mass (Da)22,379
- Last updated1996-10-01 v2
- Checksum4BD9880898FE1DBD
P11985-2
- Name2
- SynonymsShort
- Differences from canonical
- 104-155: Missing
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A338P777 | A0A338P777_MOUSE | Dynlt2a2 | 49 | ||
A0A338P6U6 | A0A338P6U6_MOUSE | Dynlt2a3 | 132 | ||
A0A0R4J284 | A0A0R4J284_MOUSE | Dynlt2a1 | 191 |
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 6-8 | in Ref. 1; AAA40413 | ||||
Sequence: RMA → QLR | ||||||
Sequence conflict | 98 | in Ref. 1; AAA40413 | ||||
Sequence: I → V | ||||||
Alternative sequence | VSP_004449 | 104-155 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 125-191 | in Ref. 1; AAA40413 | ||||
Sequence: GILAAVKEFAYHRYKFIIQVLFIQKTGQAINIASRWIWDVAWDNWVEAKHETESYVVLALVFALYCE → QYWQQSKNFIPWIYYYTSIIYSKDWSSNKYCQQMDLGCGMGQLGRS |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M26332 EMBL· GenBank· DDBJ | AAA40413.1 EMBL· GenBank· DDBJ | mRNA | ||
U21673 EMBL· GenBank· DDBJ | AAA81010.1 EMBL· GenBank· DDBJ | mRNA | ||
U21674 EMBL· GenBank· DDBJ | AAA81011.1 EMBL· GenBank· DDBJ | mRNA | ||
AK006370 EMBL· GenBank· DDBJ | BAB24552.1 EMBL· GenBank· DDBJ | mRNA | ||
AY172988 EMBL· GenBank· DDBJ | AAO34134.1 EMBL· GenBank· DDBJ | mRNA | ||
BC061136 EMBL· GenBank· DDBJ | AAH61136.1 EMBL· GenBank· DDBJ | mRNA | ||
BC131981 EMBL· GenBank· DDBJ | AAI31982.1 EMBL· GenBank· DDBJ | mRNA | ||
BC131983 EMBL· GenBank· DDBJ | AAI31984.1 EMBL· GenBank· DDBJ | mRNA |