P11955 · CHI1_HORVU
- Protein26 kDa endochitinase 1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids318 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Defense against chitin-containing fungal pathogens.
Catalytic activity
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 142 | Proton donor | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | chitin binding | |
Molecular Function | chitinase activity | |
Biological Process | cell wall macromolecule catabolic process | |
Biological Process | chitin catabolic process | |
Biological Process | defense response | |
Biological Process | polysaccharide catabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended name26 kDa endochitinase 1
- EC number
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Pooideae > Triticodae > Triticeae > Hordeinae > Hordeum
Accessions
- Primary accessionP11955
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-19 | |||||
Sequence: MRAFVLFAVVAMAATMAVA | ||||||
Chain | PRO_0000005296 | 20-318 | 26 kDa endochitinase 1 | |||
Sequence: EQCGSQAGGATCPNCLCCSRFGWCGSTPYCGDGCQSQCSGCGGGSTPVTPTPSGGGGVSSIVSRALFDRMLLHRNDGACQAKGFYTYDAFVAAASAFRGFGTTGGTDTRKREVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGATSNYCTPSAQWPCAPGKSYYGRGPIQLSHNYNYGPAGRAIGVDLLRNPDLVATDPTVSFKTAMWFWMTAQAPKPSSHAVITGQWSPSGTDRAAGRVPGFGVITNIVNGGIECGHGQDSRVADRIGFYKRYCDILGVGYGNNLDCYSQRPFA | ||||||
Disulfide bond | 22↔37 | |||||
Sequence: CGSQAGGATCPNCLCC | ||||||
Disulfide bond | 31↔43 | |||||
Sequence: CPNCLCCSRFGWC | ||||||
Disulfide bond | 36↔49 | |||||
Sequence: CCSRFGWCGSTPYC | ||||||
Disulfide bond | 53↔57 | |||||
Sequence: CQSQC | ||||||
Disulfide bond | 98↔160 | |||||
Sequence: CQAKGFYTYDAFVAAASAFRGFGTTGGTDTRKREVAAFLAQTSHETTGGWATAPDGAFAWGYC | ||||||
Disulfide bond | 172↔180 | |||||
Sequence: CTPSAQWPC | ||||||
Disulfide bond | 279↔311 | |||||
Sequence: CGHGQDSRVADRIGFYKRYCDILGVGYGNNLDC |
Keywords
- PTM
Expression
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 20-59 | Chitin-binding type-1 | ||||
Sequence: EQCGSQAGGATCPNCLCCSRFGWCGSTPYCGDGCQSQCSG |
Sequence similarities
Belongs to the glycosyl hydrolase 19 family. Chitinase class I subfamily.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length318
- Mass (Da)33,402
- Last updated1997-11-01 v4
- Checksum42D62B2FE8041954