P11672 · NGAL_MOUSE
- ProteinNeutrophil gelatinase-associated lipocalin
- GeneLcn2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids200 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development (PubMed:12453413).
Binds iron through association with 2,3-dihydroxybenzoic acid (2,3-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity; limits bacterial proliferation by sequestering iron bound to microbial siderophores, such as enterobactin (PubMed:15531878, PubMed:16446425).
Can also bind siderophores from M.tuberculosis (By similarity).
Binds iron through association with 2,3-dihydroxybenzoic acid (2,3-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity; limits bacterial proliferation by sequestering iron bound to microbial siderophores, such as enterobactin (PubMed:15531878, PubMed:16446425).
Can also bind siderophores from M.tuberculosis (By similarity).
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 72-74 | a carboxymycobactin (UniProtKB | ChEBI) | ||||
Sequence: YST | ||||||
Binding site | 128 | enterobactin (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 147 | a carboxymycobactin (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 156 | a carboxymycobactin (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 156 | enterobactin (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 160 | a carboxymycobactin (UniProtKB | ChEBI) | ||||
Sequence: Y |
GO annotations
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNeutrophil gelatinase-associated lipocalin
- Short namesNGAL
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP11672
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Upon binding to the SLC22A17 (24p3R) receptor, it is internalized (PubMed:16377569).
Releases the bound iron in the acidic lumen of cytoplasmic vesicles (By similarity).
Releases the bound iron in the acidic lumen of cytoplasmic vesicles (By similarity).
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Mice are normal with no visible phenotype. They however show an increased susceptibility to bacterial infections. Neutrophils show significantly less bacteriostatic activity.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 13 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, modified residue, chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MALSVMCLGLALLGVLQSQA | ||||||
Modified residue | 21 | Pyrrolidone carboxylic acid | ||||
Sequence: Q | ||||||
Chain | PRO_0000017934 | 21-200 | Neutrophil gelatinase-associated lipocalin | |||
Sequence: QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN | ||||||
Glycosylation | 81 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 85 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 98↔197 | |||||
Sequence: CRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQC |
Post-translational modification
N-glycosylated.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the cortical tubules of the kidney (at protein level) (PubMed:30418175).
Also expressed in the medullary tubules of the kidney (PubMed:30418175).
Detected in lung, spleen, uterus, vagina and epididymis (PubMed:8687399).
Also expressed in the medullary tubules of the kidney (PubMed:30418175).
Detected in lung, spleen, uterus, vagina and epididymis (PubMed:8687399).
Induction
Upon Toll-like receptor (TLRs) stimuli (PubMed:15531878).
By SV-40 (PubMed:15531878).
By insulin (PubMed:30418175).
By SV-40 (PubMed:15531878).
By insulin (PubMed:30418175).
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length200
- Mass (Da)22,875
- Last updated1989-10-01 v1
- ChecksumDD9A8D08750E6863
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0A6YW77 | A0A0A6YW77_MOUSE | Lcn2 | 271 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X14607 EMBL· GenBank· DDBJ | CAA32762.1 EMBL· GenBank· DDBJ | mRNA | ||
X81627 EMBL· GenBank· DDBJ | CAA57283.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK149774 EMBL· GenBank· DDBJ | BAE29077.1 EMBL· GenBank· DDBJ | mRNA | ||
AL808027 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH466542 EMBL· GenBank· DDBJ | EDL08545.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC132069 EMBL· GenBank· DDBJ | AAI32070.1 EMBL· GenBank· DDBJ | mRNA | ||
BC132071 EMBL· GenBank· DDBJ | AAI32072.1 EMBL· GenBank· DDBJ | mRNA | ||
S82469 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |