P11643 · IAAD_HORVU
- ProteinAlpha-amylase/trypsin inhibitor CMd
- GeneIAT3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids171 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Part of a complex with inhibitory activity, but CMd is inactive as a separate subunit.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | alpha-amylase inhibitor activity | |
Molecular Function | serine-type endopeptidase inhibitor activity |
Keywords
- Molecular function
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameAlpha-amylase/trypsin inhibitor CMd
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Pooideae > Triticodae > Triticeae > Hordeinae > Hordeum
Accessions
- Primary accessionP11643
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-24 | |||||
Sequence: MACKSSRSLLLLATVMVSVFAAAA | ||||||
Chain | PRO_0000014352 | 25-171 | Alpha-amylase/trypsin inhibitor CMd | |||
Sequence: AAAAATDCSPGVAFPTNLLGHCRDYVLQQTCAVFTPGSKLPEWMTSAELNYPGQPYLAKLYCCQELAEIPQQCRCEALRYFMALPVPSQPVDPSTGNVGQSGLMDLPGCPREMQRDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI |
Post-translational modification
Five disulfide bonds, which are essential for the inhibitor activity, are probably present.
Keywords
- PTM
Expression
Interaction
Subunit
Heterotetramer of one CMa, one CMb and two CMd chains.
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length171
- Mass (Da)18,526
- Last updated1994-10-01 v2
- Checksum8D8934FED808FED4
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X69939 EMBL· GenBank· DDBJ | CAA49557.1 EMBL· GenBank· DDBJ | mRNA | ||
U47641 EMBL· GenBank· DDBJ | AAB63441.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X13198 EMBL· GenBank· DDBJ | CAA31585.1 EMBL· GenBank· DDBJ | mRNA |