P11632 · NHP6A_YEAST
- ProteinNon-histone chromosomal protein 6A
- GeneNHP6A
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex. Required for transcriptional initiation fidelity of some but not all tRNA genes. Seems to be functionally redundant with NHP6B.
Miscellaneous
Present with 3870 molecules/cell in log phase SD medium.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 21-89 | HMG box | ||||
Sequence: PKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELYN |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromosome | |
Cellular Component | nucleus | |
Cellular Component | protein-DNA complex | |
Molecular Function | DNA binding, bending | |
Molecular Function | MutSalpha complex binding | |
Molecular Function | nucleic acid binding | |
Molecular Function | nucleosome binding | |
Biological Process | chromatin organization | |
Biological Process | chromatin remodeling | |
Biological Process | DNA repair | |
Biological Process | maintenance of transcriptional fidelity during transcription elongation by RNA polymerase III | |
Biological Process | protein-DNA complex assembly | |
Biological Process | RNA polymerase II preinitiation complex assembly | |
Biological Process | RNA polymerase III preinitiation complex assembly |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNon-histone chromosomal protein 6A
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP11632
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Colocalizes with both RNA polymerase II and some regions that are not transcribed on chromatin.
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 18 | Does not affect affinity for DNA. | ||||
Sequence: P → A | ||||||
Mutagenesis | 21 | Shows a 4-fold reduced affinity for DNA. | ||||
Sequence: P → A | ||||||
Mutagenesis | 28 | Shows a strongly reduced affinity for linear and circular DNA. | ||||
Sequence: Y → D | ||||||
Mutagenesis | 29 | Unable to form 75 bp microcircles. | ||||
Sequence: M → A or D | ||||||
Mutagenesis | 30 | Does not affect affinity for DNA. | ||||
Sequence: F → V | ||||||
Mutagenesis | 31 | Shows a strongly reduced affinity for linear and circular DNA. | ||||
Sequence: F → D |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1 variant from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000048565 | 1-93 | Non-histone chromosomal protein 6A | |||
Sequence: MVTPREPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELYNATLA |
Proteomic databases
PTM databases
Interaction
Subunit
Weakly associates with the stable SPT16-POB3 heterodimer to form the FACT (yFACT or SNP) complex, which is associated with nucleosomes. Multiple molecules of NHP6 (NHP6A and/or NHP6B) are required to recruit the SPT16-POB3 heterodimer to DNA.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P11632 | STH1 P32597 | 3 | EBI-12019, EBI-18410 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-23 | Disordered | ||||
Sequence: MVTPREPKKRTTRKKKDPNAPKR | ||||||
Compositional bias | 69-86 | Basic and acidic residues | ||||
Sequence: PYEAKAQADKKRYESEKE | ||||||
Region | 69-93 | Disordered | ||||
Sequence: PYEAKAQADKKRYESEKELYNATLA |
Sequence similarities
Belongs to the NHP6 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length93
- Mass (Da)10,802
- Last updated1989-10-01 v1
- ChecksumA227296A12D440D8
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 69-86 | Basic and acidic residues | ||||
Sequence: PYEAKAQADKKRYESEKE |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X15317 EMBL· GenBank· DDBJ | CAA33377.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M95912 EMBL· GenBank· DDBJ | AAA34754.1 EMBL· GenBank· DDBJ | Genomic RNA | ||
Z49219 EMBL· GenBank· DDBJ | CAA89171.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z71255 EMBL· GenBank· DDBJ | CAA94998.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY693230 EMBL· GenBank· DDBJ | AAT93249.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006949 EMBL· GenBank· DDBJ | DAA11475.1 EMBL· GenBank· DDBJ | Genomic DNA |