P11299 · VE2_BPV2
- ProteinRegulatory protein E2
- GeneE2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids411 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Plays a role in the initiation of viral DNA replication. A dimer of E2 interacts with a dimer of E1 in order to improve specificity of E1 DNA binding activity. Once the complex recognizes and binds DNA at specific sites, the E2 dimer is removed from DNA. E2 also regulates viral transcription through binding to the E2RE response element (5'-ACCNNNNNNGGT-3') present in multiple copies in the regulatory regions of the viral genome. Activates or represses transcription depending on E2RE's position with regards to proximal promoter elements including the TATA-box. Repression occurs by sterically hindering the assembly of the transcription initiation complex.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | nucleotide binding | |
Biological Process | DNA replication | |
Biological Process | DNA-templated transcription | |
Biological Process | regulation of DNA replication | |
Biological Process | viral DNA genome replication |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameRegulatory protein E2
Gene names
Organism names
- Taxonomic lineageViruses > Monodnaviria > Shotokuvirae > Cossaviricota > Papovaviricetes > Zurhausenvirales > Papillomaviridae > Firstpapillomavirinae > Deltapapillomavirus > Bovine papillomavirus type 1
- Virus hosts
Accessions
- Primary accessionP11299
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000133173 | 1-411 | Regulatory protein E2 | |||
Sequence: METACERLHVAQETQMQLIEKASDKLQDHILYWTAVRTENTLLYAARKKGVTVLGHCRVPHSVVCQERAKQAIEMQLSLQELSKTEFGNEPWCLLDTSWDRYMSEPKRCFKKGARVVEVEFDGNASNTNWYTVYSKLYMRTEDGWQLAKAGADGTGLYYCTMAGAGRIYYSRFGEEAARFSTTGHYSVRDQDRVYAGVSSTSSDFRDRPDGVSASEGPEGDPAGKEAEPAQPVSSLLGSPACVPIRAGLGWVRDGPRPHPYHFPAGSGGSLLRSASTPVQGPVPVDLAPRQEEEENQSPDSTEEEPVTVPRHTSDADGFHLLKAGQSCFALISGSANQVKCYRFRVKKNHRHRYENCTTTSFTVADNGAERQGQAQILITFGSPGQRQDFLKHVPLPPGMNISGFTASLDF |
Post-translational modification
Phosphorylated.
Keywords
- PTM
Expression
Keywords
- Developmental stage
Interaction
Subunit
Binds DNA as homodimer. Interacts with protein E1; this interaction greatly increases E1 DNA-binding activity. Interacts with protein L1; this interaction enhances E2-dependent replication and transcription activation. Interacts with protein L2; this interaction inhibits E2 transcriptional activity but not DNA replication function E2. Interacts with protein E7; this interaction inhibits E7 oncogenic activity. Interacts with host TAF1; this interaction modulates E2-dependent transcriptional regulation. Interacts with host BRD4; this interaction mediates E2 transcriptional activation function. Additionally, the interaction with host BRD4 on mitotic chromosomes mediates tethering of the viral genome. Interacts with host TOPBP1; this interaction is required for optimal viral DNA replication.
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-202 | Transactivation domain | ||||
Sequence: METACERLHVAQETQMQLIEKASDKLQDHILYWTAVRTENTLLYAARKKGVTVLGHCRVPHSVVCQERAKQAIEMQLSLQELSKTEFGNEPWCLLDTSWDRYMSEPKRCFKKGARVVEVEFDGNASNTNWYTVYSKLYMRTEDGWQLAKAGADGTGLYYCTMAGAGRIYYSRFGEEAARFSTTGHYSVRDQDRVYAGVSSTS | ||||||
Region | 197-237 | Disordered | ||||
Sequence: GVSSTSSDFRDRPDGVSASEGPEGDPAGKEAEPAQPVSSLL | ||||||
Region | 260-314 | Disordered | ||||
Sequence: PYHFPAGSGGSLLRSASTPVQGPVPVDLAPRQEEEENQSPDSTEEEPVTVPRHTS | ||||||
Region | 326-411 | DNA-binding domain | ||||
Sequence: QSCFALISGSANQVKCYRFRVKKNHRHRYENCTTTSFTVADNGAERQGQAQILITFGSPGQRQDFLKHVPLPPGMNISGFTASLDF |
Sequence similarities
Belongs to the papillomaviridae E2 protein family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length411
- Mass (Da)45,411
- Last updated1989-07-01 v1
- Checksum3051BC88ABCB77C2