P10838 · MP_RCNMV
- ProteinMovement protein
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids317 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Plays an essential role in cell-to-cell movement and long-distance transport of the viral genome. Mechanistically, movement protein is recruited by viral replicase complexes formed on RNA1 to punctate structures on the host cortical endoplasmic reticulum. In turn, interacts with the viral genome and mediates virion movement from cell to cell. Acts also as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell endoplasmic reticulum membrane | |
Cellular Component | host cell wall | |
Cellular Component | membrane | |
Biological Process | symbiont-mediated suppression of host innate immune response | |
Biological Process | transport of virus in host, cell to cell | |
Biological Process | virus-mediated perturbation of host defense response |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameMovement protein
- Short namesMP
Gene names
Organism names
- Strain
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Kitrinoviricota > Tolucaviricetes > Tolivirales > Tombusviridae > Regressovirinae > Dianthovirus > Dianthovirus trifolii
- Virus hosts
Accessions
- Primary accessionP10838
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Targeting of virus movement protein to the host endoplasmic reticulum membrane is associated with the replication of viral RNA-1 but not that of RNA-2.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000222898 | 1-317 | Movement protein | |||
Sequence: MAVHVENLSDLAKTNDGVAVSLNRYTDWKCRSGVSEAPLIPASMMSKITDYAKTTAKGNSVALNYTHVVLSLAPTIGVAIPGHVTVELINPNVEGPFQVMSGQTLSWSPGAGKPCLMIFSVHHQLNSDHEPFRVRITNTGIPTKKSYARCHAYWGFDVGTRHRYYKSEPARLIELEVGYQRTLLSSIKAVEAYVQFTFDTSRMEKNPQLCTKSNVNIIPPKAETGSIRGIAPPLSVVPNQGRESKVLKQKGGTGSKTTKLPSLEPSSGSSSGLSMSRRSHRNVLNSSIPIKRNQDGNWLGDHLSDKGRVTDPNPERL |
Interaction
Subunit
Interacts with host glyceraldehyde 3-phosphate dehydrogenase-A/NbGAPDH-A; this interaction plays a positive role in cell-to-cell movement of the virus.
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 223-317 | Disordered | ||||
Sequence: ETGSIRGIAPPLSVVPNQGRESKVLKQKGGTGSKTTKLPSLEPSSGSSSGLSMSRRSHRNVLNSSIPIKRNQDGNWLGDHLSDKGRVTDPNPERL | ||||||
Compositional bias | 250-293 | Polar residues | ||||
Sequence: KGGTGSKTTKLPSLEPSSGSSSGLSMSRRSHRNVLNSSIPIKRN | ||||||
Compositional bias | 298-317 | Basic and acidic residues | ||||
Sequence: WLGDHLSDKGRVTDPNPERL |
Domain
The C-terminal domain is essential for localization to cortical punctate structures at an early stage of infection.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length317
- Mass (Da)34,647
- Last updated1989-07-01 v1
- ChecksumD35D428028740AA1
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 250-293 | Polar residues | ||||
Sequence: KGGTGSKTTKLPSLEPSSGSSSGLSMSRRSHRNVLNSSIPIKRN | ||||||
Compositional bias | 298-317 | Basic and acidic residues | ||||
Sequence: WLGDHLSDKGRVTDPNPERL |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X08021 EMBL· GenBank· DDBJ | CAA30822.1 EMBL· GenBank· DDBJ | Genomic RNA |