P10762 · APL3_LOCMI
- ProteinApolipophorin-3b
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids179 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Assists in the loading of diacylglycerol, generated from triacylglycerol stores in the fat body through the action of adipokinetic hormone, into lipophorin, the hemolymph lipoprotein. It increases the lipid carrying capacity of lipophorin by covering the expanding hydrophobic surface resulting from diacylglycerol uptake. It thus plays a critical role in the transport of lipids during flight in several species of insects.
Miscellaneous
Two isoforms of apolipophorin-3 (a and b) have been found and occur in a ratio of 5a:9b in the hemolymph.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Biological Process | lipid transport |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameApolipophorin-3b
- Alternative names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Polyneoptera > Orthoptera > Caelifera > Acrididea > Acridomorpha > Acridoidea > Acrididae > Oedipodinae > Locusta
Accessions
- Primary accessionP10762
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-16 | |||||
Sequence: MNTLLAVLMLAVAAQA | ||||||
Chain | PRO_0000002046 | 17-179 | Apolipophorin-3b | |||
Sequence: RPDAAGHVNIAEAVQQLNHTIVNAAHELHETLGLPTPDEALNLLTEQANAFKTKIAEVTTSLKQEAEKHQGSVAEQLNRFARNLNNSIHDAATSAQPADQLNSLQSALTNVGHQWQTSQPRPSVAQEAWAPVQSALQEAAEKTKEAAANLQNSIQSAVQKPAN | ||||||
Glycosylation | 34 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 101 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
PTM databases
Expression
Tissue specificity
Hemolymph.
Interaction
Subunit
Equilibrium between a soluble monomer and a bound lipoprotein form. Apolipophorin-3 associates with lipophorin during lipid loading until each particle contains 14 molecules of apolipophorin-3 in L.migratoria (5 molecules of apolipophorin-3a and 9 of apolipophorin-3b).
Structure
Family & Domains
Features
Showing features for repeat, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 30-40 | |||||
Sequence: VQQLNHTIVNA | ||||||
Repeat | 41-52 | |||||
Sequence: AHELHETLGLPT | ||||||
Repeat | 53-60 | |||||
Sequence: PDEALNLL | ||||||
Repeat | 61-78 | |||||
Sequence: TEQANAFKTKIAEVTTSL | ||||||
Repeat | 79-89 | |||||
Sequence: KQEAEKHQGSV | ||||||
Repeat | 90-99 | |||||
Sequence: AEQLNRFARN | ||||||
Repeat | 100-113 | |||||
Sequence: LNNSIHDAATSAQP | ||||||
Repeat | 114-127 | |||||
Sequence: ADQLNSLQSALTNV | ||||||
Repeat | 128-140 | |||||
Sequence: GHQWQTSQPRPSV | ||||||
Repeat | 141-151 | |||||
Sequence: AQEAWAPVQSA | ||||||
Repeat | 152-165 | |||||
Sequence: LQEAAEKTKEAAAN | ||||||
Region | 152-179 | Disordered | ||||
Sequence: LQEAAEKTKEAAANLQNSIQSAVQKPAN | ||||||
Compositional bias | 162-179 | Polar residues | ||||
Sequence: AAANLQNSIQSAVQKPAN | ||||||
Repeat | 166-179 | |||||
Sequence: LQNSIQSAVQKPAN |
Sequence similarities
Belongs to the insect apolipophorin-3 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length179
- Mass (Da)19,113
- Last updated1989-07-01 v1
- Checksum43F38EA477DF5079
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 95 | in Ref. 1; AAA29282 | ||||
Sequence: R → A | ||||||
Sequence conflict | 111-114 | in Ref. 1; AAA29282 | ||||
Sequence: AQPA → LNLQ | ||||||
Sequence conflict | 133-140 | in Ref. 1; AAA29282 | ||||
Sequence: TSQPRPSV → DIATKTQAS | ||||||
Compositional bias | 162-179 | Polar residues | ||||
Sequence: AAANLQNSIQSAVQKPAN |
Keywords
- Technical term