P10220 · LTP_HHV11
- ProteinLarge tegument protein deneddylase
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids3164 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Large tegument protein that plays multiple roles in the viral cycle. During viral entry, remains associated with the capsid while most of the tegument is detached and participates in the capsid transport toward the host nucleus. Plays a role in the routing of the capsid at the nuclear pore complex and subsequent uncoating. Within the host nucleus, acts as a deneddylase and promotes the degradation of nuclear CRLs (cullin-RING ubiquitin ligases) and thereby stabilizes nuclear CRL substrates, while cytoplasmic CRLs remain unaffected. These modifications prevent host cell cycle S-phase progression and create a favorable environment allowing efficient viral genome replication. Participates later in the secondary envelopment of capsids. Indeed, plays a linker role for the association of the outer viral tegument to the capsids together with the inner tegument protein.
Catalytic activity
Features
Showing features for site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 52 | Important for catalytic activity | ||||
Sequence: Q | ||||||
Active site | 65 | |||||
Sequence: C | ||||||
Active site | 197 | |||||
Sequence: D | ||||||
Active site | 199 | |||||
Sequence: H |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | host cell cytoplasm | |
Cellular Component | host cell nucleus | |
Cellular Component | viral tegument | |
Molecular Function | cysteine-type deubiquitinase activity | |
Molecular Function | deNEDDylase activity | |
Molecular Function | deubiquitinase activity | |
Biological Process | nuclear capsid assembly | |
Biological Process | proteolysis | |
Biological Process | symbiont-mediated perturbation of host ubiquitin-like protein modification | |
Biological Process | symbiont-mediated suppression of cytoplasmic pattern recognition receptor signaling pathway | |
Biological Process | viral DNA genome replication |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameLarge tegument protein deneddylase
- EC number
Gene names
Organism names
- Strains
- Taxonomic lineageViruses > Duplodnaviria > Heunggongvirae > Peploviricota > Herviviricetes > Herpesvirales > Orthoherpesviridae > Alphaherpesvirinae > Simplexvirus > Simplexvirus humanalpha1 > Human herpesvirus 1
- Virus hosts
Accessions
- Primary accessionP10220
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Tightly associated with the capsid.
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 65 | Complete loss of deubiquitination activity. | ||||
Sequence: C → A | ||||||
Natural variant | 234 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: A → T | ||||||
Natural variant | 307 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: P → T | ||||||
Natural variant | 375-379 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: Missing | ||||||
Natural variant | 392 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: T → P | ||||||
Natural variant | 620 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: N → S | ||||||
Natural variant | 624 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: W → R | ||||||
Natural variant | 671 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: A → V | ||||||
Natural variant | 885 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: I → M | ||||||
Natural variant | 1023 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: A → V | ||||||
Natural variant | 1244 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: V → G | ||||||
Natural variant | 1373 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: G → S | ||||||
Natural variant | 1389 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: G → D | ||||||
Natural variant | 1419 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: T → M | ||||||
Natural variant | 1470 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: A → T | ||||||
Natural variant | 1604 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: A → S | ||||||
Natural variant | 1605 | in strain: 17 syn+ and Nonneuroinvasive mutant HF10 | ||||
Sequence: H → D | ||||||
Natural variant | 1642 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: E → D | ||||||
Natural variant | 1695 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: V → L | ||||||
Natural variant | 1729 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: G → S | ||||||
Natural variant | 1777 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: R → C | ||||||
Natural variant | 1888 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: V → M | ||||||
Natural variant | 1973 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: E → K | ||||||
Natural variant | 2267 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: V → A | ||||||
Natural variant | 2540 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: V → A | ||||||
Natural variant | 2545 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: A → T | ||||||
Natural variant | 2646 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: F → V | ||||||
Natural variant | 2666 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: P → T | ||||||
Natural variant | 2748 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: A → S | ||||||
Natural variant | 2856 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: A → T | ||||||
Natural variant | 2875 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: A → T | ||||||
Natural variant | 2894 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: T → A | ||||||
Natural variant | 2973-2978 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: Missing | ||||||
Natural variant | 3095 | in strain: Nonneuroinvasive mutant HF10 | ||||
Sequence: V → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 33 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000116035 | 1-3164 | Large tegument protein deneddylase | |||
Sequence: MGGGNNTNPGGPVHKQAGSLASRAHMIAGTPPHSTMERGGDRDIVVTGARNQFAPDLEPGGSVSCMRSSLSFLSLIFDVGPRDVLSAEAIEGCLVEGGEWTRATAGPGPPRMCSIVELPNFLEYPGARGGLRCVFSRVYGEVGFFGEPAAGLLETQCPAHTFFAGPWALRPLSYTLLTIGPLGMGLFRDGDTAYLFDPHGLPEGTPAFIAKVRAGDMYPYLTYYTRDRPDVRWAGAMVFFVPSGPEPAAPADLTAAALHLYGASETYLQDEAFSERRVAITHPLRGEIAGLGEPCVGVGPREGVGGPGPHPPTAAQSPPPTRARRDDRASETSRGTAGPSAKPEAKRPNRAPDDVWAVALKGTPPTDPPSADPPSADPPSAIPPPPPSAPKTPAAEAAEEDDDDMRVLEMGVVPVGRHRARYSAGLPKRRRPTWTPPSSVEDLTSGEKTKRSAPPAKTKKKSTPKGKTPVGAAVPASVPEPVLASAPPDPAGPPVAEAGEDDGPTVPASSQALEALKTRRSPEPPGADLAQLFEAHPNVAATAVKFTACSAALAREVAACSRLTISALRSPYPASPGLLELCVIFFFERVLAFLIENGARTHTQAGVAGPAAALLEFTLNMLPWKTAVGDFLASTRLSLADVAAHLPLVQHVLDENSLIGRLALAKLILVARDVIRETDAFYGELADLELQLRAAPPANLYTRLGEWLLERSQAHPDTLFAPATPTHPEPLLYRVQALAKFARGEEIRVEAEDRQMREALDALARGVDAVSQHAGPLGVMPAPAGAAPQGAPRPPPLGPEAVQVRLEEVRTQARRAIEGAVKEYFYRGAVYSAKALQASDNNDRRFHVASAAVVPVVQLLESLPVFDQHTRDIAQRAAIPAPPPIATSPTAILLRDLIQRGQTLDAPEDLAAWLSVLTDAANQGLIERKPLDELARSIRDINDQQARRSSGLAELRRFDALDAALGQQLDSDAAFVPAPGASPYPDDGGLSPEATRMAEEALRQARAMDAAKLTAELAPDARARLRERARSLEAMLEGARERAKVARDAREKFLHKLQGVLRPLPDFVGLKACPAVLATLRASLPAGWSDLPEAVRGAPPEVTAALRADMWGLLGQYRDALEHPTPDTATALSGLHPSFVVVLKNLFADAPETPFLLQFFADHAPIIAHAVSNAINAGSAAVATADPASTVDAAVRAHRVLVDAVTALGAAASDPASPLAFLAAMADSAAGYVKATRLALDARVAIAQLTTLGSAAADLVVQVRRAANQPEGEHASLIQAATRATTGARESLAGHEGRFGGLLHAEGTAGDHSPSGRALQELGKVIGATRRRADELEAATADLREKMAAQRARSSHERWAADVEAVLDRVESGAEFDVVELRRLQALAGTHGYNPRDFRKRAEQALGTNAKAVTLALETALAFNPYTPENQRHPMLPPLAAIHRIDWSAAFGAAADTYADMFRVDTEPLARLLRLAGGLLERAQANDGFIDYHEAVLHLSEDLGGVPALRQYVPFFQKGYAEYVDIRDRLDALRADARRAIGSVALDLAAAAEEISAVRNDPAAAAELVRAGVTLPCPSEDALVACVAALERVDQSPVKDTAYAHYVAFVTRQDLADTKDAVVRAKQQRAEATERVTAGLREVLAARERRAQLEAEGLANLKTLLKVVAVPATVAKTLDQARSAEEIADQVEILVDQTEKARELDVQAVAWLEHAQRTFETHPLSAASGDGPGLLTRQGARLQALFDTRRRVEALRRSLEEAEAEWDEVWGRFGRVRGGAWKSPEGFRAACEQLRALQDTTNTVSGLRAQRDYERLPAKYQGVLGAKSAERAGAVEELGGRVAQHADLSARLRDEVVPRVAWEMNFDTLGGLLAEFDAVAGDLAPWAVEEFRGARELIQRRMGLYSAYAKATGQTGAGAAAAPAPLLVDLRALDARARASAPPGQEADPQMLRRRGEAYLRVSGGPGPLVLREATSTLDRPFAPSFLVPDGTPLQYALCFPAVTDKLGALLMCPEAACIRPPLPTDTLESASTVTAMYVLTVINRLQLALSDAQAANFQLFGRFVRHRQARWGASMDAAAELYVALVATTLTREFGCRWAQLEWGGDAAAPGPPLGPQSSTRHRVSFNENDVLVALVASSPEHIYTFWRLDLVRQHEYMHLTLPRAFQNAADSMLFVQRLTPHPDARIRVLPAFSAGGPPTRGLMFGTRLADWRRGKLSETDPLAPWRSVPELGTERGAALGKLSPAQALAAVSVLGRMCLPSTALVALWTCMFPDDYTEYDSFDALLTARLESGQTLSPSGGREASPPAPPNALYRPTGQHVAVPAAATHRTPAARVTAMDLVLAAVLLGAPVVVALRNTTAFSRESELELCLTLFDSRARGPDAALRDAVSSDIETWAVRLLHADLNPIENACLAAQLPRLSALIAERPLARGPPCLVLVDISMTPVAVLWENPDPPGPPDVRFVGSEATEELPFVAGGEDVLAASATDEDPFLARAILGRPFDASLLSGELFPGHPVYQRAPDDQSPSVPNPTPGPVDLVGAEGSLGPGSLAPTLFTDATPGEPVPPRMWAWIHGLEELASDDSGGPAPLLAPDPLSPTADQSVPTSQCAPRPPGPAVTAREARPGVPAESTRPAPVGPRDDFRRLPSPQSSPAPPDATAPRPPASSRASAASSSGSRARRHRRARSLARATQASATTQGWRPPALPDTVAPVTDFARPPAPPKPPEPAPHALVSGVPLPLGPQAAGQASPALPIDPVPPPVATGTVLPGGENRRPPLTSGPAPTPPRVPVGGPQRRLTRPAVASLSESRESLPSPWDPADPTAPVLGRNPAEPTSSSPAGPSPPPPAVQPVAPPPTSGPPPTYLTLEGGVAPGGPVSRRPTTRQPVATPTTSARPRGHLTVSRLSAPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQNGHVAPGEYPAVRFRAPQNRPSVPASASSTNPRTGSSLSGVSSWASSLALHIDATPPPVSLLQTLYVSDDEDSDATSLFLSDSEAEALDPLPGEPHSPITNEPFSALSADDSQEVTRLQFGPPPVSANAVLSRRYVQRTGRSALAVLIRACYRLQQQLQRTRRALLHHSDAVLTSLHHVRMLLG |
Post-translational modification
Proteolytically processed, possibly into several polypeptides. Enzymatic activity is only detectable following cleavage of the UL36 protein, which occurs late during viral replication.
Interaction
Subunit
Interacts with host CUL1 and CUL4A; these interactions inhibit the E3 ligase activity of cullins. Interacts with inner tegument protein. Interacts with capsid vertex specific component CVC2. Interacts with the major capsid protein/MCP (By similarity).
Interacts with VP16; this interaction is important for outer tegument association to the capsid. May form homodimers
Interacts with VP16; this interaction is important for outer tegument association to the capsid. May form homodimers
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P10220 | UL37 P10221 | 2 | EBI-7694334, EBI-6880600 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain, compositional bias, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-273 | Deubiquitination activity | ||||
Sequence: MGGGNNTNPGGPVHKQAGSLASRAHMIAGTPPHSTMERGGDRDIVVTGARNQFAPDLEPGGSVSCMRSSLSFLSLIFDVGPRDVLSAEAIEGCLVEGGEWTRATAGPGPPRMCSIVELPNFLEYPGARGGLRCVFSRVYGEVGFFGEPAAGLLETQCPAHTFFAGPWALRPLSYTLLTIGPLGMGLFRDGDTAYLFDPHGLPEGTPAFIAKVRAGDMYPYLTYYTRDRPDVRWAGAMVFFVPSGPEPAAPADLTAAALHLYGASETYLQDEAF | ||||||
Domain | 45-263 | Peptidase C76 | ||||
Sequence: VVTGARNQFAPDLEPGGSVSCMRSSLSFLSLIFDVGPRDVLSAEAIEGCLVEGGEWTRATAGPGPPRMCSIVELPNFLEYPGARGGLRCVFSRVYGEVGFFGEPAAGLLETQCPAHTFFAGPWALRPLSYTLLTIGPLGMGLFRDGDTAYLFDPHGLPEGTPAFIAKVRAGDMYPYLTYYTRDRPDVRWAGAMVFFVPSGPEPAAPADLTAAALHLYGA | ||||||
Region | 289-508 | Disordered | ||||
Sequence: AGLGEPCVGVGPREGVGGPGPHPPTAAQSPPPTRARRDDRASETSRGTAGPSAKPEAKRPNRAPDDVWAVALKGTPPTDPPSADPPSADPPSAIPPPPPSAPKTPAAEAAEEDDDDMRVLEMGVVPVGRHRARYSAGLPKRRRPTWTPPSSVEDLTSGEKTKRSAPPAKTKKKSTPKGKTPVGAAVPASVPEPVLASAPPDPAGPPVAEAGEDDGPTVPA | ||||||
Compositional bias | 366-392 | Pro residues | ||||
Sequence: TDPPSADPPSADPPSAIPPPPPSAPKT | ||||||
Region | 426-432 | Nuclear localization signal | ||||
Sequence: LPKRRRP | ||||||
Region | 579-609 | Interaction with inner tegument protein | ||||
Sequence: LELCVIFFFERVLAFLIENGARTHTQAGVAG | ||||||
Region | 579-609 | Interaction with UL37 | ||||
Sequence: LELCVIFFFERVLAFLIENGARTHTQAGVAG | ||||||
Region | 2296-2318 | Disordered | ||||
Sequence: QTLSPSGGREASPPAPPNALYRP | ||||||
Region | 2518-2552 | Disordered | ||||
Sequence: HPVYQRAPDDQSPSVPNPTPGPVDLVGAEGSLGPG | ||||||
Region | 2583-3020 | Disordered | ||||
Sequence: ASDDSGGPAPLLAPDPLSPTADQSVPTSQCAPRPPGPAVTAREARPGVPAESTRPAPVGPRDDFRRLPSPQSSPAPPDATAPRPPASSRASAASSSGSRARRHRRARSLARATQASATTQGWRPPALPDTVAPVTDFARPPAPPKPPEPAPHALVSGVPLPLGPQAAGQASPALPIDPVPPPVATGTVLPGGENRRPPLTSGPAPTPPRVPVGGPQRRLTRPAVASLSESRESLPSPWDPADPTAPVLGRNPAEPTSSSPAGPSPPPPAVQPVAPPPTSGPPPTYLTLEGGVAPGGPVSRRPTTRQPVATPTTSARPRGHLTVSRLSAPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQNGHVAPGEYPAVRFRAPQNRPSVPASASSTNPRTGSSLSG | ||||||
Compositional bias | 2719-2736 | Pro residues | ||||
Sequence: FARPPAPPKPPEPAPHAL | ||||||
Compositional bias | 2840-2865 | Pro residues | ||||
Sequence: SSPAGPSPPPPAVQPVAPPPTSGPPP | ||||||
Compositional bias | 2885-2911 | Polar residues | ||||
Sequence: TTRQPVATPTTSARPRGHLTVSRLSAP | ||||||
Repeat | 2911-2912 | 1 | ||||
Sequence: PQ | ||||||
Region | 2911-2980 | 35 X 2 AA tandem repeats of P-Q | ||||
Sequence: PQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQ | ||||||
Compositional bias | 2912-2980 | Pro residues | ||||
Sequence: QPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQ | ||||||
Repeat | 2913-2914 | 2 | ||||
Sequence: PQ | ||||||
Repeat | 2915-2916 | 3 | ||||
Sequence: PQ | ||||||
Repeat | 2917-2918 | 4 | ||||
Sequence: PQ | ||||||
Repeat | 2919-2920 | 5 | ||||
Sequence: PQ | ||||||
Repeat | 2921-2922 | 6 | ||||
Sequence: PQ | ||||||
Repeat | 2923-2924 | 7 | ||||
Sequence: PQ | ||||||
Repeat | 2925-2926 | 8 | ||||
Sequence: PQ | ||||||
Repeat | 2927-2928 | 9 | ||||
Sequence: PQ | ||||||
Repeat | 2929-2930 | 10 | ||||
Sequence: PQ | ||||||
Repeat | 2931-2932 | 11 | ||||
Sequence: PQ | ||||||
Repeat | 2933-2934 | 12 | ||||
Sequence: PQ | ||||||
Repeat | 2935-2936 | 13 | ||||
Sequence: PQ | ||||||
Repeat | 2937-2938 | 14 | ||||
Sequence: PQ | ||||||
Repeat | 2939-2940 | 15 | ||||
Sequence: PQ | ||||||
Repeat | 2941-2942 | 16 | ||||
Sequence: PQ | ||||||
Repeat | 2943-2944 | 17 | ||||
Sequence: PQ | ||||||
Repeat | 2945-2946 | 18 | ||||
Sequence: PQ | ||||||
Repeat | 2947-2948 | 19 | ||||
Sequence: PQ | ||||||
Repeat | 2949-2950 | 20 | ||||
Sequence: PQ | ||||||
Repeat | 2951-2952 | 21 | ||||
Sequence: PQ | ||||||
Repeat | 2953-2954 | 22 | ||||
Sequence: PQ | ||||||
Repeat | 2955-2956 | 23 | ||||
Sequence: PQ | ||||||
Repeat | 2957-2958 | 24 | ||||
Sequence: PQ | ||||||
Repeat | 2959-2960 | 25 | ||||
Sequence: PQ | ||||||
Repeat | 2961-2962 | 26 | ||||
Sequence: PQ | ||||||
Repeat | 2963-2964 | 27 | ||||
Sequence: PQ | ||||||
Repeat | 2965-2966 | 28 | ||||
Sequence: PQ | ||||||
Repeat | 2967-2968 | 29 | ||||
Sequence: PQ | ||||||
Repeat | 2969-2970 | 30 | ||||
Sequence: PQ | ||||||
Repeat | 2971-2972 | 31 | ||||
Sequence: PQ | ||||||
Repeat | 2973-2974 | 32 | ||||
Sequence: PQ | ||||||
Repeat | 2975-2976 | 33 | ||||
Sequence: PQ | ||||||
Repeat | 2977-2978 | 34 | ||||
Sequence: PQ | ||||||
Repeat | 2979-2980 | 35 | ||||
Sequence: PQ | ||||||
Compositional bias | 3001-3020 | Polar residues | ||||
Sequence: PSVPASASSTNPRTGSSLSG |
Sequence similarities
Belongs to the herpesviridae large tegument protein family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length3,164
- Mass (Da)335,862
- Last updated1989-07-01 v1
- ChecksumCC5D31FF4F9FE3F4
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 366-392 | Pro residues | ||||
Sequence: TDPPSADPPSADPPSAIPPPPPSAPKT | ||||||
Compositional bias | 2719-2736 | Pro residues | ||||
Sequence: FARPPAPPKPPEPAPHAL | ||||||
Compositional bias | 2840-2865 | Pro residues | ||||
Sequence: SSPAGPSPPPPAVQPVAPPPTSGPPP | ||||||
Compositional bias | 2885-2911 | Polar residues | ||||
Sequence: TTRQPVATPTTSARPRGHLTVSRLSAP | ||||||
Compositional bias | 2912-2980 | Pro residues | ||||
Sequence: QPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQ | ||||||
Compositional bias | 3001-3020 | Polar residues | ||||
Sequence: PSVPASASSTNPRTGSSLSG |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X14112 EMBL· GenBank· DDBJ | CAA32311.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
DQ889502 EMBL· GenBank· DDBJ | ABI63498.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FJ593289 EMBL· GenBank· DDBJ | ACM62259.1 EMBL· GenBank· DDBJ | Genomic DNA |