P0DUP4 · APOC2_TAPTE
- ProteinApolipoprotein C-II
- GeneAPOC2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids101 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Component of chylomicrons, very low-density lipoproteins (VLDL), low-density lipoproteins (LDL), and high-density lipoproteins (HDL) in plasma. Plays an important role in lipoprotein metabolism as an activator of lipoprotein lipase. Both proapolipoprotein C-II and apolipoprotein C-II can activate lipoprotein lipase.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chylomicron | |
Cellular Component | intermediate-density lipoprotein particle | |
Cellular Component | low-density lipoprotein particle | |
Cellular Component | spherical high-density lipoprotein particle | |
Cellular Component | very-low-density lipoprotein particle | |
Molecular Function | lipid binding | |
Molecular Function | lipoprotein lipase activator activity | |
Molecular Function | phospholipase activator activity | |
Molecular Function | phospholipase binding | |
Biological Process | chylomicron remnant clearance | |
Biological Process | high-density lipoprotein particle clearance | |
Biological Process | lipid catabolic process | |
Biological Process | lipid transport | |
Biological Process | negative regulation of very-low-density lipoprotein particle clearance | |
Biological Process | positive regulation of phospholipid catabolic process |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameApolipoprotein C-II
- Short namesApo-CII; ApoC-II
- Alternative names
- Cleaved into 1 chains
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Perissodactyla > Tapiridae > Tapirus
Accessions
- Primary accessionP0DUP4
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MGARHLLALLLVLLVLGFEVQG | ||||||
Chain | PRO_0000452906 | 23-101 | Proapolipoprotein C-II | |||
Sequence: AQVPQQDEAANTTLLTQVQESLLSYWDSTKAAAQDLYKKTYLTTMDEKIRDMFSKSTAAVSTYVGIFTDQLLSLLKGED | ||||||
Chain | PRO_0000452907 | 29-101 | Apolipoprotein C-II | |||
Sequence: DEAANTTLLTQVQESLLSYWDSTKAAAQDLYKKTYLTTMDEKIRDMFSKSTAAVSTYVGIFTDQLLSLLKGED |
Post-translational modification
Proapolipoprotein C-II is synthesized as a sialic acid containing glycoprotein which is subsequently desialylated prior to its proteolytic processing.
Proapolipoprotein C-II, the major form found in plasma undergoes proteolytic cleavage of its N-terminal hexapeptide to generate apolipoprotein C-II, which occurs as the minor form in plasma.
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 66-74 | Lipid binding | ||||
Sequence: TMDEKIRDM | ||||||
Region | 78-101 | Lipoprotein lipase cofactor | ||||
Sequence: STAAVSTYVGIFTDQLLSLLKGED |
Sequence similarities
Belongs to the apolipoprotein C2 family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length101
- Mass (Da)11,172
- Last updated2021-06-02 v1
- ChecksumA976572238F8CB02