P0DTC7 · NS7A_SARS2
- ProteinORF7a protein
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids121 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role as antagonist of host tetherin (BST2), disrupting its antiviral effect (PubMed:33930332).
Acts by binding to BST2 and sequestering it to perinuclear region, thereby preventing its antiviral function at cell membrane (PubMed:33930332).
May specifically downregulate MHC-I allele HLA-A*02:01 (HLA-A2) (PubMed:36574644).
Acts by binding to BST2 and sequestering it to perinuclear region, thereby preventing its antiviral function at cell membrane (PubMed:33930332).
May specifically downregulate MHC-I allele HLA-A*02:01 (HLA-A2) (PubMed:36574644).
Miscellaneous
Variant B.1.1.7 is also called Variant Of Concern (VOC) 202012/01, Variant Under Investigation (VUI) 202012/01, or 20B/501Y.V1.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell endoplasmic reticulum membrane | |
Cellular Component | host cell endoplasmic reticulum-Golgi intermediate compartment membrane | |
Cellular Component | host cell Golgi membrane | |
Cellular Component | host cell perinuclear region of cytoplasm | |
Cellular Component | membrane | |
Cellular Component | virion membrane | |
Biological Process | suppression by virus of host tetherin activity | |
Biological Process | symbiont-mediated perturbation of host cell cycle G0/G1 transition checkpoint | |
Biological Process | symbiont-mediated suppression of host antigen processing and presentation of peptide antigen via MHC class I | |
Biological Process | symbiont-mediated suppression of host innate immune response |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameORF7a protein
- Short namesORF7a
- Alternative names
Gene names
Organism names
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Pisuviricota > Pisoniviricetes > Nidovirales > Cornidovirineae > Coronaviridae > Orthocoronavirinae > Betacoronavirus > Sarbecovirus > Severe acute respiratory syndrome coronavirus
- Virus hosts
Accessions
- Primary accessionP0DTC7
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Host endoplasmic reticulum membrane ; Single-pass membrane protein
Host endoplasmic reticulum-Golgi intermediate compartment membrane ; Single-pass type I membrane protein
Host Golgi apparatus membrane ; Single-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 96-116 | Helical | ||||
Sequence: LYSPIFLIVAAIVFITLCFTL |
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis, natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 2 | No effect on ubiquitination. | ||||
Sequence: K → A | ||||||
Natural variant | 14 | in strain: Alpha/B.1.1.7 | ||||
Sequence: T → I | ||||||
Mutagenesis | 32 | No effect on ubiquitination. | ||||
Sequence: K → A | ||||||
Mutagenesis | 53 | No effect on ubiquitination. | ||||
Sequence: K → A | ||||||
Mutagenesis | 72 | No effect on ubiquitination. | ||||
Sequence: K → A | ||||||
Natural variant | 82 | in strain: Delta/B.1.617.2 and Kappa/B.1.617.1 | ||||
Sequence: V → A | ||||||
Mutagenesis | 85 | No effect on ubiquitination. | ||||
Sequence: K → A | ||||||
Mutagenesis | 117 | No effect on ubiquitination. | ||||
Sequence: K → A | ||||||
Mutagenesis | 117-119 | Complete loss of MHC-I retention in ER. | ||||
Sequence: KRK → ARA | ||||||
Mutagenesis | 119 | Complete loss of ubiquitination. Partial loss of interferon pathway inhibition. | ||||
Sequence: K → A | ||||||
Natural variant | 120 | in strain: Delta/B.1.617.2 | ||||
Sequence: T → I |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 4 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-15 | |||||
Sequence: MKIILFLALITLATC | ||||||
Chain | PRO_0000449654 | 16-121 | ORF7a protein | |||
Sequence: ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE | ||||||
Disulfide bond | 23↔58 | |||||
Sequence: CVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTC | ||||||
Disulfide bond | 35↔67 | |||||
Sequence: CSSGTYEGNSPFHPLADNKFALTCFSTQFAFAC | ||||||
Cross-link | 119 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K |
Post-translational modification
Poly-ubiquitinated by host with K63-linked polyubiquitin chains.
Keywords
- PTM
PTM databases
Interaction
Subunit
Interacts with host BST2 (PubMed:33930332).
Interacts with the spike glycoprotein (By similarity).
Interacts with M protein (By similarity).
Interacts with E protein (By similarity).
Interacts with the ORF3a protein (By similarity).
Interacts with the spike glycoprotein (By similarity).
Interacts with M protein (By similarity).
Interacts with E protein (By similarity).
Interacts with the ORF3a protein (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P0DTC7 | 7b P0DTD8 | 5 | EBI-25475903, EBI-25475914 | |
BINARY | P0DTC7 | rep PRO_0000449625 P0DTD1 | 3 | EBI-25475903, EBI-25475871 |
Protein-protein interaction databases
Family & Domains
Features
Showing features for region, domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 16-80 | Ig-like fold | ||||
Sequence: ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRAR | ||||||
Domain | 16-81 | X4e | ||||
Sequence: ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARS | ||||||
Region | 83-95 | Disordered | ||||
Sequence: SPKLFIRQEEVQE | ||||||
Motif | 117-119 | ER-retrieval motif | ||||
Sequence: KRK |
Domain
The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length121
- Mass (Da)13,744
- Last updated2020-04-22 v1
- Checksum891E7EAB9E8A5BA9
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
MN908947 EMBL· GenBank· DDBJ | QHD43421.1 EMBL· GenBank· DDBJ | Genomic RNA |