P0DTC4 · VEMP_SARS2
- ProteinEnvelope small membrane protein
- GeneE
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a central role in virus morphogenesis and assembly. Acts as a viroporin and self-assembles in host membranes forming pentameric protein-lipid pores that allow ion transport. Also plays a role in the induction of apoptosis (By similarity).
Regulates the localization of S protein at cis-Golgi, the place of virus budding (PubMed:33229438).
May act by slowing down the cell secretory pathway (PubMed:33229438).
May interfere with tight-junction stability by interacting with host MPP5. This would result in disruption of epithelial barriers, thereby amplifying inflammatory processes (PubMed:32891874).
Regulates the localization of S protein at cis-Golgi, the place of virus budding (PubMed:33229438).
May act by slowing down the cell secretory pathway (PubMed:33229438).
May interfere with tight-junction stability by interacting with host MPP5. This would result in disruption of epithelial barriers, thereby amplifying inflammatory processes (PubMed:32891874).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum-Golgi intermediate compartment | |
Cellular Component | host cell Golgi membrane | |
Cellular Component | membrane | |
Cellular Component | virion membrane | |
Molecular Function | identical protein binding | |
Molecular Function | monoatomic ion channel activity | |
Molecular Function | structural constituent of virion | |
Biological Process | apoptotic process | |
Biological Process | cytoplasmic capsid assembly | |
Biological Process | disruption of cellular anatomical structure in another organism | |
Biological Process | viral budding from Golgi membrane |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameEnvelope small membrane protein
- Short namesE; sM protein
Gene names
Organism names
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Pisuviricota > Pisoniviricetes > Nidovirales > Cornidovirineae > Coronaviridae > Orthocoronavirinae > Betacoronavirus > Sarbecovirus > Severe acute respiratory syndrome coronavirus
- Virus hosts
Accessions
- Primary accessionP0DTC4
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Host Golgi apparatus membrane ; Single-pass type III membrane protein
Note: The cytoplasmic tail functions as a Golgi complex-targeting signal.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-13 | Virion surface | ||||
Sequence: MYSFVSEETGTLI | ||||||
Transmembrane | 14-34 | Helical | ||||
Sequence: VNSVLLFLAFVVFLLVTLAIL | ||||||
Topological domain | 35-75 | Intravirion | ||||
Sequence: TALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV |
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 9 | in strain: Omicron/BA.1, Omicron/BA.2, Omicron/BA.2.12.1, Omicron/BA.2.75, Omicron/BA.4, Omicron/BA.5, Omicron/BQ.1.1, Omicron/XBB.1.5 | ||||
Sequence: T → I | ||||||
Natural variant | 11 | in strain: Omicron/XBB.1.5, Omicron/EG.5.1 | ||||
Sequence: T → A | ||||||
Natural variant | 21 | in strain: Eta/B.1.525 | ||||
Sequence: L → F | ||||||
Natural variant | 71 | in strain: Beta/B.1.351 | ||||
Sequence: P → L | ||||||
Mutagenesis | 71 | Complete loss of interaction with host PARD3 and MLLT4. Partial loss of interaction with host ZO1. | ||||
Sequence: P → L |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 7 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000449651 | 1-75 | Envelope small membrane protein | |||
Sequence: MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV |
Interaction
Subunit
Homopentamer (PubMed:33177698).
Interacts via C-terminus PDM domain with PDZ domain-containing host proteins such as PALS1/MPP5 (PubMed:32891874, PubMed:35283834), TJP1/ZO1 (PubMed:35283834), LNX2 (PubMed:35283834), PARD3 (PubMed:35283834), and AFDN/MLLT4 (PubMed:35283834).
This may lead to disruption of tight junctions between epithelial cells (PubMed:32891874).
Interacts with membrane protein M in the budding compartment of the host cell, which is located between endoplasmic reticulum and the Golgi complex. Interacts with Nucleoprotein (By similarity).
Interacts via C-terminus PDM domain with PDZ domain-containing host proteins such as PALS1/MPP5 (PubMed:32891874, PubMed:35283834), TJP1/ZO1 (PubMed:35283834), LNX2 (PubMed:35283834), PARD3 (PubMed:35283834), and AFDN/MLLT4 (PubMed:35283834).
This may lead to disruption of tight junctions between epithelial cells (PubMed:32891874).
Interacts with membrane protein M in the budding compartment of the host cell, which is located between endoplasmic reticulum and the Golgi complex. Interacts with Nucleoprotein (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P0DTC4 | 7b P0DTD8 | 5 | EBI-25475850, EBI-25475914 | |
XENO | P0DTC4 | BAG4 O95429 | 3 | EBI-25475850, EBI-2949658 | |
XENO | P0DTC4 | C1QBP PRO_0000018590 Q07021 | 2 | EBI-25475850, EBI-14032968 | |
BINARY | P0DTC4 | E P0DTC4 | 6 | EBI-25475850, EBI-25475850 | |
BINARY | P0DTC4 | M P0DTC5 | 5 | EBI-25475850, EBI-25475853 | |
BINARY | P0DTC4 | N P0DTC9 | 3 | EBI-25475850, EBI-25475856 | |
XENO | P0DTC4 | PALS1 Q8N3R9 | 6 | EBI-25475850, EBI-2513978 | |
XENO | P0DTC4 | PROP1 O75360 | 3 | EBI-25475850, EBI-9027467 | |
XENO | P0DTC4 | TMEM258 P61165 | 3 | EBI-25475850, EBI-12019210 | |
XENO | P0DTC4 | ZC3H18 Q86VM9 | 3 | EBI-25475850, EBI-1045965 |
Protein-protein interaction databases
Family & Domains
Features
Showing features for region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 61-75 | Disordered | ||||
Sequence: RVKNLNSSRVPDLLV | ||||||
Motif | 72-75 | PDZ-binding; required for interaction with human MPP5 | ||||
Sequence: DLLV |
Sequence similarities
Belongs to the betacoronaviruses E protein family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length75
- Mass (Da)8,365
- Last updated2020-04-22 v1
- Checksum5C431BD2AA1B6B99
Polymorphism
Variant Omicron/BA.1 and BA.2 belong to a lineage first isolated in South Africa (November 2021).
Variant Omicron/BQ.1.1 belongs to a lineage first isolated in Nigeria (November 2022).
Variant Omicron/XBB.1.5 belongs to a lineage first isolated in United States (November 2022). It is the result of recombination between omicron BJ.1 and BM.1.1. Moreover XBB.1.5 do not express ORF8.
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
MN908947 EMBL· GenBank· DDBJ | QHD43418.1 EMBL· GenBank· DDBJ | Genomic RNA |