P0DQL6 · LAN2D_RUMFL

Function

function

Lanthionine-containing peptide that does probably not show antibacterial activity, since its analog [+2]Flvbeta.d does not show antibacterial activity against M.luteus (PubMed:27028884).
Also does not show antibiotic activity when tested with [Del2]Flvalpha.a, an analog of Flvalpha.a, which is encoded by the same operon than Flvbeta.d (PubMed:27028884).
The bactericidal activity of lantibiotics is based on depolarization of energized bacterial cytoplasmic membranes, initiated by the formation of aqueous transmembrane pores (By similarity).

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentextracellular region

Names & Taxonomy

Protein names

  • Recommended name
    Lantipeptide Flvbeta.d

Gene names

    • Name
      FlvA2.d

Organism names

  • Taxonomic identifier
  • Strain
    • FD-1
  • Taxonomic lineage
    Bacteria > Bacillota > Clostridia > Eubacteriales > Oscillospiraceae > Ruminococcus

Accessions

  • Primary accession
    P0DQL6

Subcellular Location

Keywords

PTM/Processing

Features

Showing features for propeptide, peptide, cross-link, modified residue.

TypeIDPosition(s)Description
PropeptidePRO_00004504021-31Cleaved by FlvT
PeptidePRO_000045040332-64Lantipeptide Flvbeta.d
Cross-link33↔37Lanthionine (Ser-Cys); by FlvM2
Modified residue342,3-didehydrobutyrine; by FlvM2
Modified residue412,3-didehydrobutyrine; by FlvM2
Cross-link44↔52Beta-methyllanthionine (Thr-Cys); by FlvM2
Cross-link47↔53Lanthionine (Ser-Cys); by FlvM2
Cross-link55↔58Beta-methyllanthionine (Thr-Cys); by FlvM2
Cross-link59↔62Beta-methyllanthionine (Thr-Cys); by FlvM2

Post-translational modification

Contains LL-lanthionine, DL-lanthionine, and DL-beta-methyllanthionine, when coepressed in E.coli with the flavecin synthetase FlvM2.

Keywords

Family & Domains

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Sequence processing
    The displayed sequence is further processed into a mature form.
  • Length
    64
  • Mass (Da)
    6,861
  • Last updated
    2020-08-12 v1
  • Checksum
    43BC7D55BE777890
MDNNTEKFNELAAIADESELNEMLDENITGAGSTIQCVNTTIGTILSVVFDCCPTSACTPPCRF

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp