P0DMS8 · AA3R_HUMAN
- ProteinAdenosine receptor A3
- GeneADORA3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids318 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Isoform 2
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | dendrite | |
Cellular Component | plasma membrane | |
Cellular Component | presynaptic membrane | |
Cellular Component | Schaffer collateral - CA1 synapse | |
Cellular Component | synapse | |
Molecular Function | G protein-coupled adenosine receptor activity | |
Biological Process | activation of adenylate cyclase activity | |
Biological Process | G protein-coupled adenosine receptor signaling pathway | |
Biological Process | inflammatory response | |
Biological Process | negative regulation of cell migration | |
Biological Process | negative regulation of cell population proliferation | |
Biological Process | negative regulation of NF-kappaB transcription factor activity | |
Biological Process | presynaptic modulation of chemical synaptic transmission | |
Biological Process | regulation of heart contraction | |
Biological Process | regulation of norepinephrine secretion | |
Biological Process | response to wounding | |
Biological Process | signal transduction |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAdenosine receptor A3
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP0DMS8
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-14 | Extracellular | ||||
Sequence: MPNNSTALSLANVT | ||||||
Transmembrane | 15-37 | Helical; Name=1 | ||||
Sequence: YITMEIFIGLCAIVGNVLVICVV | ||||||
Topological domain | 38-48 | Cytoplasmic | ||||
Sequence: KLNPSLQTTTF | ||||||
Transmembrane | 49-72 | Helical; Name=2 | ||||
Sequence: YFIVSLALADIAVGVLVMPLAIVV | ||||||
Topological domain | 73-84 | Extracellular | ||||
Sequence: SLGITIHFYSCL | ||||||
Transmembrane | 85-106 | Helical; Name=3 | ||||
Sequence: FMTCLLLIFTHASIMSLLAIAV | ||||||
Topological domain | 107-126 | Cytoplasmic | ||||
Sequence: DRYLRVKLTVRYKRVTTHRR | ||||||
Transmembrane | 127-148 | Helical; Name=4 | ||||
Sequence: IWLALGLCWLVSFLVGLTPMFG | ||||||
Topological domain | 149-177 | Extracellular | ||||
Sequence: WNMKLTSEYHRNVTFLSCQFVSVMRMDYM | ||||||
Transmembrane | 178-198 | Helical; Name=5 | ||||
Sequence: VYFSFLTWIFIPLVVMCAIYL | ||||||
Topological domain | 199-231 | Cytoplasmic | ||||
Sequence: DIFYIIRNKLSLNLSNSKETGAFYGREFKTAKS | ||||||
Transmembrane | 232-255 | Helical; Name=6 | ||||
Sequence: LFLVLFLFALSWLPLSIINCIIYF | ||||||
Topological domain | 256-261 | Extracellular | ||||
Sequence: NGEVPQ | ||||||
Transmembrane | 262-284 | Helical; Name=7 | ||||
Sequence: LVLYMGILLSHANSMMNPIVYAY | ||||||
Topological domain | 285-318 | Cytoplasmic | ||||
Sequence: KIKKFKETYLLILKACVVCHPSDSLDTSIEKNSE |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_035755 | 105 | in a colorectal cancer sample; somatic mutation; dbSNP:rs746154553 | |||
Sequence: A → T | ||||||
Natural variant | VAR_049366 | 248 | in dbSNP:rs35511654 | |||
Sequence: I → L | ||||||
Natural variant | VAR_049367 | 266 | in dbSNP:rs2800889 | |||
Sequence: M → K |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 359 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, glycosylation, disulfide bond, lipidation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000069010 | 1-318 | Adenosine receptor A3 | |||
Sequence: MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIAVGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKRVTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFALSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKACVVCHPSDSLDTSIEKNSE | ||||||
Glycosylation | 3 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 4 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 12 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 83↔166 | |||||
Sequence: CLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKRVTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSC | ||||||
Lipidation | 303 | S-palmitoyl cysteine | ||||
Sequence: C |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Gene expression databases
Organism-specific databases
Structure
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
P0DMS8-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name2
- SynonymsA3AR i2, A3AR
- Length318
- Mass (Da)36,185
- Last updated2015-04-01 v1
- Checksum690E67986130FC28
P0DMS9-2
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name1
- SynonymsTMIGD3 i1, A3AR i1
P0DMS9-1
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name3
- SynonymsTMIGD3 i3, A3AR i3
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0J9YWR0 | A0A0J9YWR0_HUMAN | ADORA3 | 123 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 7 | in Ref. 1; AAA16365 | ||||
Sequence: A → T | ||||||
Sequence conflict | 175 | in Ref. 8; AAG35155 | ||||
Sequence: D → V |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L20463 EMBL· GenBank· DDBJ | AAA16365.1 EMBL· GenBank· DDBJ | mRNA | ||
L22607 EMBL· GenBank· DDBJ | AAA35949.1 EMBL· GenBank· DDBJ | mRNA | ||
X76981 EMBL· GenBank· DDBJ | CAA54288.1 EMBL· GenBank· DDBJ | mRNA | ||
L77730 EMBL· GenBank· DDBJ | AAB02790.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
L77729 EMBL· GenBank· DDBJ | AAB02790.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY136749 EMBL· GenBank· DDBJ | AAN01275.1 EMBL· GenBank· DDBJ | mRNA | ||
AL390195 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC029831 EMBL· GenBank· DDBJ | AAH29831.1 EMBL· GenBank· DDBJ | mRNA | ||
AY011231 EMBL· GenBank· DDBJ | AAG35155.1 EMBL· GenBank· DDBJ | Genomic DNA |