P0DL42 · TXVE_DABSI

Function

function

Snake venom VEGFs may contribute to venom dispersion and prey subjugation by inducing vascular permeability and hypotension. This protein stimulates vascular endothelial cell proliferation (EC50=0.2 nM) in a similar manner than VR-1 and vammin (PubMed:15992764).
This angiogenesis probably occurs through VEGF receptor (KDR/VEGFR-2) signaling. Also induces drastic hypotension mediated by nitric oxide (NO), which is produced by VEGF-activated endothelium NO synthase. Also induces vascular permeability (By similarity).

Miscellaneous

The new subtype VEGF-F is proposed to group snake venom VEGFs that specifically bind to KDR/VEGFR-2.

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentextracellular space
Cellular Componentmembrane
Molecular Functionchemoattractant activity
Molecular Functiongrowth factor activity
Molecular Functiontoxin activity
Molecular Functionvascular endothelial growth factor receptor 1 binding
Biological Processinduction of positive chemotaxis
Biological Processpositive regulation of angiogenesis
Biological Processpositive regulation of endothelial cell proliferation
Biological Processpositive regulation of mast cell chemotaxis
Biological Processpositive regulation of protein phosphorylation
Biological Processresponse to hypoxia
Biological Processsprouting angiogenesis
Biological Processvascular endothelial growth factor receptor signaling pathway
Biological Processvascular endothelial growth factor signaling pathway

Keywords

Names & Taxonomy

Protein names

  • Recommended name
    Snake venom vascular endothelial growth factor toxin VR-1'
  • Short names
    svVEGF
  • Alternative names
    • VEGF-F

Organism names

Accessions

  • Primary accession
    P0DL42

Subcellular Location

Keywords

PTM/Processing

Features

Showing features for modified residue, chain, disulfide bond.

TypeIDPosition(s)Description
Modified residue1Pyrrolidone carboxylic acid (Glu)
ChainPRO_00004330351-109Snake venom vascular endothelial growth factor toxin VR-1'
Disulfide bond14↔56
Disulfide bond39Interchain (with C-48)
Disulfide bond45↔91
Disulfide bond48Interchain (with C-39)
Disulfide bond49↔93

Keywords

Expression

Tissue specificity

Expressed by the venom gland.

Interaction

Subunit

Homodimer; disulfide-linked.

Structure

Family & Domains

Sequence similarities

Family and domain databases

Sequence

  • Sequence status
    Complete
  • Length
    109
  • Mass (Da)
    12,554
  • Last updated
    2015-05-27 v1
  • Checksum
    7765E67F8CF929E3
EVRPFLDVYQRSACQTRETLVSILQEHPDEISDIFRPSCVAVLRCSGCCTDESMKCTPVGKHTADIQIMRMNPRTHSSKMEVMKFMEHTACECRPRWKQGEPEGPKEPR

Keywords

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp