P0DL42 · TXVE_DABSI
- ProteinSnake venom vascular endothelial growth factor toxin VR-1'
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids109 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Snake venom VEGFs may contribute to venom dispersion and prey subjugation by inducing vascular permeability and hypotension. This protein stimulates vascular endothelial cell proliferation (EC50=0.2 nM) in a similar manner than VR-1 and vammin (PubMed:15992764).
This angiogenesis probably occurs through VEGF receptor (KDR/VEGFR-2) signaling. Also induces drastic hypotension mediated by nitric oxide (NO), which is produced by VEGF-activated endothelium NO synthase. Also induces vascular permeability (By similarity).
This angiogenesis probably occurs through VEGF receptor (KDR/VEGFR-2) signaling. Also induces drastic hypotension mediated by nitric oxide (NO), which is produced by VEGF-activated endothelium NO synthase. Also induces vascular permeability (By similarity).
Miscellaneous
The new subtype VEGF-F is proposed to group snake venom VEGFs that specifically bind to KDR/VEGFR-2.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Cellular Component | membrane | |
Molecular Function | chemoattractant activity | |
Molecular Function | growth factor activity | |
Molecular Function | toxin activity | |
Molecular Function | vascular endothelial growth factor receptor 1 binding | |
Biological Process | induction of positive chemotaxis | |
Biological Process | positive regulation of angiogenesis | |
Biological Process | positive regulation of endothelial cell proliferation | |
Biological Process | positive regulation of mast cell chemotaxis | |
Biological Process | positive regulation of protein phosphorylation | |
Biological Process | response to hypoxia | |
Biological Process | sprouting angiogenesis | |
Biological Process | vascular endothelial growth factor receptor signaling pathway | |
Biological Process | vascular endothelial growth factor signaling pathway |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameSnake venom vascular endothelial growth factor toxin VR-1'
- Short namessvVEGF
- Alternative names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Lepidosauria > Squamata > Bifurcata > Unidentata > Episquamata > Toxicofera > Serpentes > Colubroidea > Viperidae > Viperinae > Daboia
Accessions
- Primary accessionP0DL42
Subcellular Location
PTM/Processing
Features
Showing features for modified residue, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Modified residue | 1 | Pyrrolidone carboxylic acid (Glu) | ||||
Sequence: E | ||||||
Chain | PRO_0000433035 | 1-109 | Snake venom vascular endothelial growth factor toxin VR-1' | |||
Sequence: EVRPFLDVYQRSACQTRETLVSILQEHPDEISDIFRPSCVAVLRCSGCCTDESMKCTPVGKHTADIQIMRMNPRTHSSKMEVMKFMEHTACECRPRWKQGEPEGPKEPR | ||||||
Disulfide bond | 14↔56 | |||||
Sequence: CQTRETLVSILQEHPDEISDIFRPSCVAVLRCSGCCTDESMKC | ||||||
Disulfide bond | 39 | Interchain (with C-48) | ||||
Sequence: C | ||||||
Disulfide bond | 45↔91 | |||||
Sequence: CSGCCTDESMKCTPVGKHTADIQIMRMNPRTHSSKMEVMKFMEHTAC | ||||||
Disulfide bond | 48 | Interchain (with C-39) | ||||
Sequence: C | ||||||
Disulfide bond | 49↔93 | |||||
Sequence: CTDESMKCTPVGKHTADIQIMRMNPRTHSSKMEVMKFMEHTACEC |
Keywords
- PTM
Expression
Tissue specificity
Expressed by the venom gland.
Interaction
Subunit
Homodimer; disulfide-linked.