P0DKK9 · RS10B_ORYSJ
- ProteinSmall ribosomal subunit protein eS10y
- GeneRPS10-2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids183 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | ribonucleoprotein complex | |
Cellular Component | ribosome |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameSmall ribosomal subunit protein eS10y
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionP0DKK9
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000116373 | 1-183 | UniProt | Small ribosomal subunit protein eS10y | |||
Sequence: MIIPKKNRNEICKYLFQEGVLYAKKDYNLAKHPQIDVPNLQVIKLMQSFKSKEYVRETFSWQYYYWYLTNDGIEHLRNYLNLPSEIVPATLKKSARPPGRPFGSGPPGDRPRGPPRFEGDRPRFGDRDGYRGGPRGAPGDFGGEKGGAPAEFQPSFRSSGGRPGFGRGGGGGFGAGPTSSSME | |||||||
Modified residue (large scale data) | 104 | PTMeXchange | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 155 | PTMeXchange | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 91-183 | Disordered | ||||
Sequence: LKKSARPPGRPFGSGPPGDRPRGPPRFEGDRPRFGDRDGYRGGPRGAPGDFGGEKGGAPAEFQPSFRSSGGRPGFGRGGGGGFGAGPTSSSME | ||||||
Compositional bias | 113-130 | Basic and acidic residues | ||||
Sequence: GPPRFEGDRPRFGDRDGY |
Sequence similarities
Belongs to the eukaryotic ribosomal protein eS10 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length183
- Mass (Da)20,263
- Last updated2016-05-11 v1
- Checksum9C913253BD517B58
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 45 | in Ref. 1; BAB21002 | ||||
Sequence: L → F | ||||||
Sequence conflict | 77 | in Ref. 1; BAB21002 | ||||
Sequence: R → L | ||||||
Sequence conflict | 92 | in Ref. 7; AK102190 | ||||
Sequence: K → E | ||||||
Compositional bias | 113-130 | Basic and acidic residues | ||||
Sequence: GPPRFEGDRPRFGDRDGY |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB054123 EMBL· GenBank· DDBJ | BAB21002.1 EMBL· GenBank· DDBJ | mRNA | ||
AL606632 EMBL· GenBank· DDBJ | CAD41005.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008210 EMBL· GenBank· DDBJ | BAF14730.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014960 EMBL· GenBank· DDBJ | BAS89251.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000141 EMBL· GenBank· DDBJ | EAZ30777.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK102190 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |