P0DKH9 · AREP1_ARATH
- ProteinAuxin-responsive endogenous peptide 1
- GeneAREP1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Negative regulator of the auxin response.
Miscellaneous
Knock-down mutants have no visible phenotype in the absence of exogenous auxin, but are more sensitive to auxin-induced inhibition of root elongation and initiation of lateral roots.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | membrane | |
Cellular Component | nucleus | |
Biological Process | auxin-activated signaling pathway | |
Biological Process | negative regulation of auxin mediated signaling pathway | |
Biological Process | root development |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameAuxin-responsive endogenous peptide 1
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionP0DKH9
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 7-29 | Helical | ||||
Sequence: LIYRLVVRCFLDYSICAPFYFYH |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000431425 | 1-40 | Auxin-responsive endogenous peptide 1 | |||
Sequence: MGLSDCLIYRLVVRCFLDYSICAPFYFYHKFMLSASEPVF |
Expression
Tissue specificity
Expressed in cotyledons, hypocotyls, roots, newly developing leaves and shoot apical meristem. Not detected in flowers, siliques or mature leaves.
Induction
Up-regulated by auxin.
Developmental stage
Expressed during the primary developmental stages.
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Length40
- Mass (Da)4,747
- Last updated2015-01-07 v1
- ChecksumF9C5C75E99E2CE63
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC023628 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CP002684 EMBL· GenBank· DDBJ | ANM60886.1 EMBL· GenBank· DDBJ | Genomic DNA |