P0DJX1 · PKG2_ADE02

Function

function

Component of the packaging machinery which encapsidates the viral DNA into preformed capsids and transcriptional activator of the viral major late promoter (MLP). Binds, along with packaging proteins 1 and 3, to the specific packaging sequence on the left end of viral genomic DNA and plays an active role in packaging of the viral genome into preformed capsids. Specifically binds to the 5'-TTTG-3' nucleotides of the repeats making up the packaging sequence. Forms a transcription factor called DEF-A through cooperative binding with packaging protein 1 (Probable). DEF-A binds to downstream elements of the major late promoter (MLP) and stimulates transcription from the MLP after initiation of viral DNA replication. Simultaneously suppresses early gene expression and is thus likely to participate in the early-late switch in the expression pattern of the late viral proteins. May as well enhance transcription from IVa2 and pIX promoters.

Miscellaneous

All late proteins expressed from the major late promoter are produced by alternative splicing and alternative polyadenylation of the same gene giving rise to non-overlapping ORFs. Expression of packaging protein 2 and splicing factor is controlled by a L4 promoter distinct from the major late promoter.

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componenthost cell nucleus
Biological Processnuclear capsid assembly
Biological Processviral DNA genome packaging

Keywords

Names & Taxonomy

Protein names

  • Recommended name
    Packaging protein 2
  • Alternative names
    • Packaging protein 22K (L4-22K)

Gene names

    • ORF names
      L4

Organism names

Accessions

  • Primary accession
    P0DJX1

Proteomes

Subcellular Location

Keywords

PTM/Processing

Features

Showing features for chain.

TypeIDPosition(s)Description
ChainPRO_00004211071-195Packaging protein 2

Expression

Induction

Expressed at the late phase of the viral replicative cycle. Probably already expressed from the early to late transition.

Keywords

Interaction

Subunit

Part of a genome packaging complex composed of packaging proteins 1, 2 and 3; this complex specifically binds to the packaging sequence on the left end of viral genomic DNA and performs packaging of the viral genome. Self-assembles into higher-order structures.

Family & Domains

Features

Showing features for compositional bias, region.

TypeIDPosition(s)Description
Compositional bias1-17Pro residues
Region1-124Disordered
Compositional bias19-51Acidic residues
Compositional bias103-124Polar residues

Sequence similarities

Family and domain databases

Sequence & Isoform

Align isoforms (2)
  • Sequence status
    Complete

This entry describes 2 isoforms produced by Alternative splicing.

P0DJX1-1

This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

  • Name
    Packaging protein 2
  • Synonyms
    Packaging protein 22K, L4-22K
  • Note
    Unspliced isoform.
  • See also
    sequence in UniParc or sequence clusters in UniRef
  • Length
    195
  • Mass (Da)
    21,543
  • Last updated
    2013-02-06 v1
  • Checksum
    0FF447098C8460AA
MAPKKKLQLPPPPPTDEEEYWDSQAEEVLDEEEEMMEDWDSLDEASEAEEVSDETPSPSVAFPSPAPQKLATVPSIATTSAPQAPPALPVRRPNRRWDTTGTRAGKSKQPPPLAQEQQQRQGYRSWRGHKNAIVACLQDCGGNISFARRFLLYHHGVAFPRNILHYYRHLYSPYCTGGSGSGSNSSGHTEAKATG

P24939-1

The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.

View isoform
  • Name
    Protein 33K
  • Synonyms
    Splicing factor 33K, L4-33K
  • See also
    sequence in UniParc or sequence clusters in UniRef

Features

Showing features for compositional bias.

TypeIDPosition(s)Description
Compositional bias1-17Pro residues
Compositional bias19-51Acidic residues
Compositional bias103-124Polar residues

Keywords

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
J01917
EMBL· GenBank· DDBJ
-Genomic DNA No translation available.

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp