P0DJI8 · SAA1_HUMAN
- ProteinSerum amyloid A-1 protein
- GeneSAA1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids122 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Major acute phase protein.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasmic microtubule | |
Cellular Component | endocytic vesicle lumen | |
Cellular Component | extracellular exosome | |
Cellular Component | extracellular region | |
Cellular Component | high-density lipoprotein particle | |
Molecular Function | G protein-coupled receptor binding | |
Molecular Function | heparin binding | |
Biological Process | acute-phase response | |
Biological Process | lymphocyte chemotaxis | |
Biological Process | macrophage chemotaxis | |
Biological Process | negative regulation of inflammatory response | |
Biological Process | neutrophil chemotaxis | |
Biological Process | platelet activation | |
Biological Process | positive regulation of cell adhesion | |
Biological Process | positive regulation of cytokine production | |
Biological Process | positive regulation of cytosolic calcium ion concentration | |
Biological Process | positive regulation of interleukin-1 production | |
Biological Process | regulation of protein secretion |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSerum amyloid A-1 protein
- Short namesSAA
- Cleaved into 6 chains
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP0DJI8
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_006925 | 15 | in dbSNP:rs1232745554 | |||
Sequence: G → S | ||||||
Mutagenesis | 19 | Reduces affinity for heparin and nearly abolishes association with HDL; when associated with A-80 and A-89. | ||||
Sequence: R → A | ||||||
Mutagenesis | 33 | Reduces affinity for heparin; when associated with A-37 and A-65. | ||||
Sequence: R → A | ||||||
Mutagenesis | 37 | Reduces affinity for heparin; when associated with A-33 and A-65. | ||||
Sequence: R → A | ||||||
Mutagenesis | 65 | Reduces affinity for heparin; when associated with A-33 and A-37. | ||||
Sequence: R → A | ||||||
Natural variant | VAR_006926 | 70 | in allele SAA1.1 | |||
Sequence: A → V | ||||||
Natural variant | VAR_006927 | 75 | in allele SAA1.1 and allele SAA1.3 | |||
Sequence: V → A | ||||||
Natural variant | VAR_088562 | 77 | requires 2 nucleotide substitutions; dbSNP:rs1671926 | |||
Sequence: T → S | ||||||
Natural variant | VAR_006928 | 78 | in allele SAA1.4; dbSNP:rs557915415 | |||
Sequence: D → N | ||||||
Mutagenesis | 80 | Reduces affinity for heparin and nearly abolishes association with HDL; when associated with A-18 and A-89. | ||||
Sequence: R → A | ||||||
Natural variant | VAR_057167 | 86 | in dbSNP:rs1059559 | |||
Sequence: F → L | ||||||
Mutagenesis | 89 | Reduces affinity for heparin and nearly abolishes association with HDL; when associated with A-18 and A-80. | ||||
Sequence: H → A | ||||||
Natural variant | VAR_006931 | 90 | in allele SAA1.2; dbSNP:rs79681911 | |||
Sequence: G → D |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 274 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, propeptide, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-18 | |||||
Sequence: MKLLTGLVFCSLVLGVSS | ||||||
Chain | PRO_0000031576 | 19-94 | Amyloid protein A | |||
Sequence: RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDS | ||||||
Chain | PRO_0000031575 | 19-122 | Serum amyloid A-1 protein | |||
Sequence: RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY | ||||||
Chain | PRO_0000031579 | 20-120 | Serum amyloid protein A(2-102) | |||
Sequence: SFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPE | ||||||
Chain | PRO_0000031578 | 20-121 | Serum amyloid protein A(2-103) | |||
Sequence: SFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEK | ||||||
Chain | PRO_0000031577 | 20-122 | Serum amyloid protein A(2-104) | |||
Sequence: SFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY | ||||||
Chain | PRO_0000031580 | 21-122 | Serum amyloid protein A(3-104) | |||
Sequence: FFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY | ||||||
Chain | PRO_0000031581 | 22-119 | Serum amyloid protein A(4-101) | |||
Sequence: FSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLP | ||||||
Propeptide | PRO_0000031582 | 95-122 | Often cleaved during amyloidogenesis | |||
Sequence: LADQAANEWGRSGKDPNHFRPAGLPEKY | ||||||
Modified residue | 101 | N4,N4-dimethylasparagine | ||||
Sequence: N |
Post-translational modification
This protein is the precursor of amyloid protein A, which is formed by the removal of approximately 24 residues from the C-terminal end.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed by the liver; secreted in plasma (at protein level).
Induction
Upon cytokine stimulation.
Gene expression databases
Organism-specific databases
Interaction
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 19-45 | Important for amyloid formation; forms amyloid fibrils in vitro | ||||
Sequence: RSFFSFLGEAFDGARDMWRAYSDMREA | ||||||
Region | 98-122 | Disordered | ||||
Sequence: QAANEWGRSGKDPNHFRPAGLPEKY |
Sequence similarities
Belongs to the SAA family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length122
- Mass (Da)13,546
- Last updated2024-01-24 v2
- Checksum8C43BF06AA47B179
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A3B3ISW8 | A0A3B3ISW8_HUMAN | SAA1 | 77 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 71 | in Ref. 10; AA sequence and 11; AA sequence | ||||
Sequence: W → R | ||||||
Sequence conflict | 96-101 | in Ref. 9; AA sequence | ||||
Sequence: ADQAAN → SEATVK | ||||||
Sequence conflict | 101 | in Ref. 6; AAH07022 | ||||
Sequence: N → D | ||||||
Sequence conflict | 119 | in Ref. 1; AAA60297 | ||||
Sequence: P → S |
Mass Spectrometry
Serum amyloid A-1 protein
Molecular mass is 11,702 Da. Determined by MALDI.Serum amyloid A-1 protein
Molecular mass is 11,682.7 Da. Determined by MALDI.Serum amyloid protein A(2-104)
Molecular mass is 11,526.5 Da. Determined by MALDI.Serum amyloid protein A(3-104)
Molecular mass is 11,439.6 Da. Determined by MALDI.Serum amyloid protein A(2-103)
Molecular mass is 11,363.6 Da. Determined by MALDI.Serum amyloid protein A(2-102)
Molecular mass is 11,235.6 Da. Determined by MALDI.Serum amyloid protein A(4-101)
Molecular mass is 10,872.6 Da. Determined by MALDI.Amyloid protein A
Molecular mass is 8,337.5 Da. Determined by Electrospray. With variants Asn-78 and 86-Leu-Thr-87.Amyloid protein A
Molecular mass is 8,390.9 Da. Determined by Electrospray.Polymorphism
At least 5 different SAA1 alleles have been described: SAA1.1 (SAA1alpha), SAA1.2 (SAA1beta), SAA1.3 (SAA1gamma), SAA1.4 (SAA1delta), SAA1.5 (also named SAA1beta but which differs from SAA1.2). We use here the revised nomenclature described in PubMed:10211414. The sequence shown is that of SAA1.2.
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M10906 EMBL· GenBank· DDBJ | AAA60297.1 EMBL· GenBank· DDBJ | mRNA | ||
M23698 EMBL· GenBank· DDBJ | AAA64799.1 EMBL· GenBank· DDBJ | mRNA | ||
X56652 EMBL· GenBank· DDBJ | CAA39974.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CR542241 EMBL· GenBank· DDBJ | CAG47037.1 EMBL· GenBank· DDBJ | mRNA | ||
AC107948 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC007022 EMBL· GenBank· DDBJ | AAH07022.1 EMBL· GenBank· DDBJ | mRNA | ||
BC105796 EMBL· GenBank· DDBJ | AAI05797.1 EMBL· GenBank· DDBJ | mRNA | ||
X51439 EMBL· GenBank· DDBJ | CAA35804.1 EMBL· GenBank· DDBJ | mRNA | ||
X51441 EMBL· GenBank· DDBJ | CAA35806.1 EMBL· GenBank· DDBJ | mRNA | ||
X51442 EMBL· GenBank· DDBJ | CAA35807.1 EMBL· GenBank· DDBJ | mRNA |