P0DI83 · NARR_HUMAN
- ProteinRas-related protein Rab-34, isoform NARR
- GeneRAB34
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids198 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleolus |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRas-related protein Rab-34, isoform NARR
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP0DI83
Proteomes
Organism-specific databases
Subcellular Location
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 256 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, chain, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Initiator methionine | 1 | UniProt | Removed | ||||
Sequence: M | |||||||
Chain | PRO_0000412533 | 2-198 | UniProt | Ras-related protein Rab-34, isoform NARR | |||
Sequence: VGQPQPRDDVGSPRPRVIVGTIRPRVIVGTIRPRVIVGSARARPPPDGTPRPQLAAEESPRPRVIFGTPRARVILGSPRPRVIVSSPWPAVVVASPRPRTPVGSPWPRVVVGTPRPRVIVGSPRARVADADPASAPSQGALQGRRQDEHSGTRAEGSRPGGAAPVPEEGGRFARAQRLPPPRHLRLPGAPDRHRGQI | |||||||
Modified residue | 13 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 13 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 69 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 78 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 87 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 96 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 96 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 123 | UniProt | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Structure
Family & Domains
Features
Showing features for repeat, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 7-15 | 1 | ||||
Sequence: PRDDVGSPR | ||||||
Region | 7-125 | 13 x 9 AA approximate tandem-repeats of P-R-V-I-V-G-(S/T)-P-R | ||||
Sequence: PRDDVGSPRPRVIVGTIRPRVIVGTIRPRVIVGSARARPPPDGTPRPQLAAEESPRPRVIFGTPRARVILGSPRPRVIVSSPWPAVVVASPRPRTPVGSPWPRVVVGTPRPRVIVGSPR | ||||||
Repeat | 16-24 | 2 | ||||
Sequence: PRVIVGTIR | ||||||
Repeat | 25-33 | 3 | ||||
Sequence: PRVIVGTIR | ||||||
Repeat | 34-42 | 4 | ||||
Sequence: PRVIVGSAR | ||||||
Region | 37-64 | Disordered | ||||
Sequence: IVGSARARPPPDGTPRPQLAAEESPRPR | ||||||
Repeat | 43-51 | 5 | ||||
Sequence: ARPPPDGTP | ||||||
Repeat | 52-60 | 6 | ||||
Sequence: RPQLAAEES | ||||||
Repeat | 61-69 | 7 | ||||
Sequence: PRPRVIFGT | ||||||
Repeat | 70-78 | 8 | ||||
Sequence: PRARVILGS | ||||||
Repeat | 79-87 | 9 | ||||
Sequence: PRPRVIVSS | ||||||
Repeat | 88-96 | 10 | ||||
Sequence: PWPAVVVAS | ||||||
Region | 94-198 | Disordered | ||||
Sequence: VASPRPRTPVGSPWPRVVVGTPRPRVIVGSPRARVADADPASAPSQGALQGRRQDEHSGTRAEGSRPGGAAPVPEEGGRFARAQRLPPPRHLRLPGAPDRHRGQI | ||||||
Repeat | 97-105 | 11 | ||||
Sequence: PRPRTPVGS | ||||||
Repeat | 106-114 | 12 | ||||
Sequence: PWPRVVVGT | ||||||
Repeat | 115-123 | 13 | ||||
Sequence: PRPRVIVGS |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing.
P0DI83-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameNARR
- Length198
- Mass (Da)21,118
- Last updated2011-09-21 v1
- ChecksumE03CF9EB3272B766
Q9BZG1-1
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name1
Q9BZG1-2
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name2
Q9BZG1-4
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Name4
Computationally mapped potential isoform sequences
There are 14 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q9BZG1 | RAB34_HUMAN | RAB34 | 259 | ||
E7ES60 | E7ES60_HUMAN | RAB34 | 268 | ||
K7EIF2 | K7EIF2_HUMAN | RAB34 | 149 | ||
C9JY26 | C9JY26_HUMAN | RAB34 | 258 | ||
A0A1B0GTQ2 | A0A1B0GTQ2_HUMAN | RAB34 | 250 | ||
A0A1B0GWB1 | A0A1B0GWB1_HUMAN | RAB34 | 228 | ||
A0A1B0GVI6 | A0A1B0GVI6_HUMAN | RAB34 | 83 | ||
C9JBG0 | C9JBG0_HUMAN | RAB34 | 210 | ||
V9GY61 | V9GY61_HUMAN | RAB34 | 48 | ||
Q96PJ7 | Q96PJ7_HUMAN | RAB34 | 211 | ||
A0A1C7CYW6 | A0A1C7CYW6_HUMAN | RAB34 | 197 | ||
H7C0Y7 | H7C0Y7_HUMAN | RAB34 | 171 | ||
K7EJW7 | K7EJW7_HUMAN | RAB34 | 51 | ||
J3QLC6 | J3QLC6_HUMAN | RAB34 | 156 |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC010761 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CX872465 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |