P0CW42 · FWDC_METMI
- ProteinTungsten-containing formylmethanofuran dehydrogenase 2 subunit C
- GenefwdC
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids272 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Catalyzes the reversible oxidation of CO2 and methanofuran (MFR) to N-formylmethanofuran (CHO-MFR). This enzyme is oxygen-labile.
Catalytic activity
- H2O + N-formylmethanofuran + 2 oxidized [2Fe-2S]-[ferredoxin] = CO2 + H+ + methanofuran + 2 reduced [2Fe-2S]-[ferredoxin]
Pathway
One-carbon metabolism; methanogenesis from CO2; 5,10-methenyl-5,6,7,8-tetrahydromethanopterin from CO2: step 1/3.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | formylmethanofuran dehydrogenase activity | |
Molecular Function | transition metal ion binding | |
Biological Process | methanogenesis, from carbon dioxide |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTungsten-containing formylmethanofuran dehydrogenase 2 subunit C
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageArchaea > Euryarchaeota > Methanomada group > Methanococci > Methanococcales > Methanococcaceae > Methanococcus
Accessions
- Primary accessionP0CW42
- Secondary accessions
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000144195 | 1-272 | Tungsten-containing formylmethanofuran dehydrogenase 2 subunit C | |||
Sequence: MNELILNLKGDVSVPVEMDKIIPEKIQEMSLEKISGIELIQGNKTAKVSEIFDVELKESPVSKVTINNCCKKVKRIGEKMTSGEIVVNGDAGMYVGVEMKGGKITVNGDAESWVGQNLKGGEIIINGNAENYVGSAYRGDWRGMSGGKITITGTAGSELGEYLKGGTIVIKGNTKIMPGIHPNGGMIIIEGDIEGRAGGEMMKGAIVVYGKTLEPLPSFKFEGIVEDPLVKLFKKDAGTQLKGTFIKFSGDYVNTKPKGQLYAAIENNKNLI |
Interaction
Subunit
This enzyme is composed of seven subunits fwdA (65 kDa), fwdB (53 kDa), fwdC (31 kDa), fwdD (15 kDa), fwdE, fwdF and fwdG.
Structure
Family & Domains
Features
Showing features for repeat, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 77-89 | 1 | ||||
Sequence: GEKMTSGEIVVNG | ||||||
Region | 77-210 | 7 X 13 AA repeats of [GW]-X-X-[MLP]-X-X-G-X-[IL]-X-[IV]-X-G | ||||
Sequence: GEKMTSGEIVVNGDAGMYVGVEMKGGKITVNGDAESWVGQNLKGGEIIINGNAENYVGSAYRGDWRGMSGGKITITGTAGSELGEYLKGGTIVIKGNTKIMPGIHPNGGMIIIEGDIEGRAGGEMMKGAIVVYG | ||||||
Repeat | 96-108 | 2 | ||||
Sequence: GVEMKGGKITVNG | ||||||
Repeat | 115-127 | 3 | ||||
Sequence: GQNLKGGEIIING | ||||||
Repeat | 141-153 | 4 | ||||
Sequence: WRGMSGGKITITG | ||||||
Repeat | 160-172 | 5 | ||||
Sequence: GEYLKGGTIVIKG | ||||||
Repeat | 179-191 | 6 | ||||
Sequence: GIHPNGGMIIIEG | ||||||
Repeat | 198-210 | 7 | ||||
Sequence: GGEMMKGAIVVYG |
Sequence similarities
Belongs to the FwdC/FmdC family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length272
- Mass (Da)29,174
- Last updated2011-05-03 v1
- Checksum50912BD8B47A4BF0