P0CK98 · CCD39_DANRE
- ProteinCoiled-coil domain-containing protein 39
- Geneccdc39
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids947 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Required for assembly of dynein regulatory complex (DRC) and inner dynein arm (IDA) complexes, which are responsible for ciliary beat regulation, thereby playing a central role in motility in cilia and flagella. Probably acts together with ccdc40 to form a molecular ruler that determines the 96 nanometer (nm) repeat length and arrangements of components in cilia and flagella. Not required for outer dynein arm complexes assembly.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axoneme | |
Cellular Component | extracellular region | |
Biological Process | axonemal dynein complex assembly | |
Biological Process | cilium-dependent cell motility | |
Biological Process | determination of left/right symmetry | |
Biological Process | epithelial cilium movement involved in determination of left/right asymmetry | |
Biological Process | inner dynein arm assembly |
Names & Taxonomy
Protein names
- Recommended nameCoiled-coil domain-containing protein 39
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionP0CK98
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Defects are the cause of a phenotype related to primary ciliary dyskinesia (PCD). Embryos display heart-looping defects at 36 hours post-fertilization and bilateral or lack of spaw expression at the left lateral plate mesoderm in 14 somite embryos, consistent with compromised fluid flow at the Kupffer's vesicle due to impaired ciliary motility.
Keywords
- Disease
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000405818 | 1-947 | Coiled-coil domain-containing protein 39 | |||
Sequence: MSSALLEEVGWDADFAIPVANAENKALEEQIRKKQKDILNLDNKLNKHKDVINALTEHLKNLKQEVSHNQALCKAKEKETESEVHLKALAERETGRLKQEITRLESQLTTLNEKKNAQENSIFKATQKIDELTSQLNWDQQTLEAFLQESAHKDEDTMAIIKYAKQDERKIKELTLNIEKLTLESNQKRKTLDNELTETVTSQIALDKTAESFRQAHTERQELISQWENTIEQMRKRDQDIQQCAMMLAELNQTIREKNDLIKERKDFLEREIENNKELERNIGTVERQAFRLRQQLQEEEKNQRRLQDEVEVLKGTVDRTATDVETSRSQLSSMKKDIQDKTTKVEEAQLHNAALEEKLRMVTEAVLNGEEQAAQMEQLLREQEQNIKEIDSQLLRQKELLFKKSQEVQALRDKEKNVTAEICATRTALSNLDSKLRKLDQNFLQQQMIISNQDFQIQMLERKTLHLQGKVNTEEKKALEKKVADLAASLEEKKKTAANLNKQLKKLQDDIRCIKKDTEKIGAEKTNLSTKIQEVELFIETSEKERKKSRLKKQDSMVEKGLLKMEVQRLRNLLYDRADGVLTLEKRRLQLQTAMKEREEEIRVHREMLNKQVKLTEQERQGLSAAVNEAMSKIDKQRKRYEVLSVSLAPPEGEEDKSQAYFIIKAAQEKEELQRKGDELDAKIRKTEKEIHALENTLQVVNNCNSTHRKALTKVTESSPAHQEKLKLEEQRRAAEEKYKYKRRQTQELQEDIESMSNTLEGLLQEEKVLNEGIERTQAHVLSLNKDILSQEEKINRAVKQCAKYTKEIRSGKQSTEKTFEERDIELRELRDFNKSINKMLLDAMEGNPELSSILQIHFTQAGLSLPSPSSTPSSRLSSKPSSARSSASLHRSSNLSASSSPRSQSVSSPQMKTVDLGLGLSVTSPRGSQPSSAGSSRSSSKCKSP |
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for coiled coil, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 16-194 | |||||
Sequence: AIPVANAENKALEEQIRKKQKDILNLDNKLNKHKDVINALTEHLKNLKQEVSHNQALCKAKEKETESEVHLKALAERETGRLKQEITRLESQLTTLNEKKNAQENSIFKATQKIDELTSQLNWDQQTLEAFLQESAHKDEDTMAIIKYAKQDERKIKELTLNIEKLTLESNQKRKTLDN | ||||||
Coiled coil | 221-402 | |||||
Sequence: QELISQWENTIEQMRKRDQDIQQCAMMLAELNQTIREKNDLIKERKDFLEREIENNKELERNIGTVERQAFRLRQQLQEEEKNQRRLQDEVEVLKGTVDRTATDVETSRSQLSSMKKDIQDKTTKVEEAQLHNAALEEKLRMVTEAVLNGEEQAAQMEQLLREQEQNIKEIDSQLLRQKELL | ||||||
Coiled coil | 471-522 | |||||
Sequence: KVNTEEKKALEKKVADLAASLEEKKKTAANLNKQLKKLQDDIRCIKKDTEKI | ||||||
Coiled coil | 582-813 | |||||
Sequence: VLTLEKRRLQLQTAMKEREEEIRVHREMLNKQVKLTEQERQGLSAAVNEAMSKIDKQRKRYEVLSVSLAPPEGEEDKSQAYFIIKAAQEKEELQRKGDELDAKIRKTEKEIHALENTLQVVNNCNSTHRKALTKVTESSPAHQEKLKLEEQRRAAEEKYKYKRRQTQELQEDIESMSNTLEGLLQEEKVLNEGIERTQAHVLSLNKDILSQEEKINRAVKQCAKYTKEIRSG | ||||||
Compositional bias | 866-916 | Polar residues | ||||
Sequence: SLPSPSSTPSSRLSSKPSSARSSASLHRSSNLSASSSPRSQSVSSPQMKTV | ||||||
Region | 866-947 | Disordered | ||||
Sequence: SLPSPSSTPSSRLSSKPSSARSSASLHRSSNLSASSSPRSQSVSSPQMKTVDLGLGLSVTSPRGSQPSSAGSSRSSSKCKSP | ||||||
Compositional bias | 924-947 | Polar residues | ||||
Sequence: VTSPRGSQPSSAGSSRSSSKCKSP |
Sequence similarities
Belongs to the CCDC39 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length947
- Mass (Da)108,989
- Last updated2015-02-04 v2
- ChecksumBBC9949973C51E69
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M1PVA8 | A0A8M1PVA8_DANRE | ccdc39 | 191 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 866-916 | Polar residues | ||||
Sequence: SLPSPSSTPSSRLSSKPSSARSSASLHRSSNLSASSSPRSQSVSSPQMKTV | ||||||
Compositional bias | 924-947 | Polar residues | ||||
Sequence: VTSPRGSQPSSAGSSRSSSKCKSP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CABZ01021592 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CABZ01055305 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CABZ01055306 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CABZ01055307 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CABZ01055310 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CABZ01068420 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CABZ01068421 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CABZ01080220 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |