P0CI42 · KBX23_LYCMC
- ProteinNeurotoxin beta-KTx 14.3
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Isoform 1
Toxin with activity on voltage-gated potassium channels. Moderately and reversibly blocks up to 50% of the activity of Kv7.1/KCNQ1 (tested at 22 uM) (PubMed:36918120).
3D-structure modeling of the KCNQ1-toxin complex shows that the toxin interacts with the channel pore domain (PubMed:36918120).
Additionally, shows a very weak effect to block voltage-gated potassium channel Kv1.1/KCNA1 (PubMed:20663230).
3D-structure modeling of the KCNQ1-toxin complex shows that the toxin interacts with the channel pore domain (PubMed:36918120).
Additionally, shows a very weak effect to block voltage-gated potassium channel Kv1.1/KCNA1 (PubMed:20663230).
Isoform 2
Has a very weak effect to block voltage-gated potassium channel Kv1.1/KCNA1 (PubMed:20663230).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | potassium channel regulator activity | |
Molecular Function | toxin activity |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameNeurotoxin beta-KTx 14.3
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Chelicerata > Arachnida > Scorpiones > Buthida > Buthoidea > Buthidae > Lychas
Accessions
- Primary accessionP0CI42
Subcellular Location
PTM/Processing
Features
Showing features for signal, propeptide, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MKQYIFFLALIVLTATFAEA | ||||||
Propeptide | PRO_0000403850 | 21-37 | ||||
Sequence: GKKTEILDKVKKVFSKG | ||||||
Chain | PRO_0000403851 | 38-85 | Neurotoxin beta-KTx 14.3 | |||
Sequence: IAGVADLNNMSELGCPFIEKWCEDHCESKKQVGKCENFDCSCVKLGGK | ||||||
Disulfide bond | 52↔72 | |||||
Sequence: CPFIEKWCEDHCESKKQVGKC | ||||||
Disulfide bond | 59↔77 | |||||
Sequence: CEDHCESKKQVGKCENFDC | ||||||
Disulfide bond | 63↔79 | |||||
Sequence: CESKKQVGKCENFDCSC |
Keywords
- PTM
Expression
Tissue specificity
Expressed by the venom gland.
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 49-85 | BetaSPN-type CS-alpha/beta | ||||
Sequence: ELGCPFIEKWCEDHCESKKQVGKCENFDCSCVKLGGK |
Domain
Contains 2 domains: a N-terminal domain that is unstructured or forms an alpha-helix in presence of membranes and a CS-alpha/beta C-terminal domain, which consists of an alpha-helix disulfide-linked to antiparallel beta-sheets.
Sequence similarities
Belongs to the long chain scorpion toxin family. Class 2 subfamily.
Keywords
- Domain
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
P0CI42-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- NoteNegative results: has no effect on insect voltage-gated potassium channel Shaker-IR (tested at 22 uM).
- Length85
- Mass (Da)9,425
- Last updated2011-01-11 v1
- Checksum4647B291E448A789
P0CI42-2
- Name2
- Differences from canonical
- 37-39: Missing
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_040456 | 37-39 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term