P0C7N0 · RWDD3_RAT
- ProteinRWD domain-containing protein 3
- GeneRwdd3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids267 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
Enhancer of SUMO conjugation. Via its interaction with UBE2I/UBC9, increases SUMO conjugation to proteins by promoting the binding of E1 and E2 enzymes, thioester linkage between SUMO and UBE2I/UBC9 and transfer of SUMO to specific target proteins which include HIF1A, PIAS, NFKBIA, NR3C1 and TOP1. Positively regulates the NF-kappa-B signaling pathway by enhancing the sumoylation of NF-kappa-B inhibitor alpha (NFKBIA), promoting its stabilization which consequently leads to an increased inhibition of NF-kappa-B transcriptional activity. Negatively regulates the hypoxia-inducible factor-1 alpha (HIF1A) signaling pathway by increasing the sumoylation of HIF1A, promoting its stabilization, transcriptional activity and the expression of its target gene VEGFA during hypoxia. Has no effect on ubiquitination.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Biological Process | negative regulation of NF-kappaB transcription factor activity | |
Biological Process | positive regulation of hypoxia-inducible factor-1alpha signaling pathway | |
Biological Process | positive regulation of protein sumoylation |
Names & Taxonomy
Protein names
- Recommended nameRWD domain-containing protein 3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionP0C7N0
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000340085 | 1-267 | RWD domain-containing protein 3 | |||
Sequence: MAEEMRQELSALAAIFCGPHEWEMLSCSETDGAVFRIHTTAEGLAGEDVPLELAFHLPAGYPSCLPGISVNSERLTRAQCVTVKEKLLGEARRLLSEPMVHELVLWTQQNLRHILSQTETESSNGTCTLPESSTVDGGLWMTLLRLDHMRARTKYVKVVEKWASELRLTGRLMFMGKMILILLQGDRSNIKEYLILQKTSKVDVDSSGKKCKEKMISVLSETKVQTEHKRFLAFEVKEYSTLEELQKEFETAGLQELFSECVLGLVK |
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Interacts with UBE2I/UBC9, NFKBIA, HIF1A and NCOA2.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 7-114 | RWD | ||||
Sequence: QELSALAAIFCGPHEWEMLSCSETDGAVFRIHTTAEGLAGEDVPLELAFHLPAGYPSCLPGISVNSERLTRAQCVTVKEKLLGEARRLLSEPMVHELVLWTQQNLRHI | ||||||
Region | 13-15 | Interaction with UBE2I/UBC9 | ||||
Sequence: AAI | ||||||
Region | 100-102 | Interaction with UBE2I/UBC9 | ||||
Sequence: VHE |
Domain
The RWD domain is required for the sumoylation enhancement activity.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length267
- Mass (Da)30,138
- Last updated2008-06-10 v1
- Checksum764BFB3384E6407A
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8I5ZTU8 | A0A8I5ZTU8_RAT | Rwdd3 | 244 | ||
A0A8L2QK58 | A0A8L2QK58_RAT | Rwdd3 | 247 |
Keywords
- Technical term