P0C783 · 2B_CMVFN
- ProteinSuppressor of silencing 2b
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids110 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Multifunctional protein that plays two independent roles: viral suppressor of host RNAi (VSR) and viral inducer of host attractiveness to insect vectors (VIA). Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs (PubMed:25380036).
May directly interfere with mobile silencing signaling (By similarity).
Also inhibits signal transduction by the phytohormone jasmonate, making the infected plant more attractive to aphids, which are the second host to play a role as a dissemination vector. Acts by binding to and inhibiting JAZ degradation in the host (By similarity).
May directly interfere with mobile silencing signaling (By similarity).
Also inhibits signal transduction by the phytohormone jasmonate, making the infected plant more attractive to aphids, which are the second host to play a role as a dissemination vector. Acts by binding to and inhibiting JAZ degradation in the host (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | host cell nucleus | |
Biological Process | symbiont-mediated suppression of host innate immune response | |
Biological Process | virus-mediated perturbation of host defense response |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSuppressor of silencing 2b
- Alternative names
Gene names
Organism names
- Taxonomic lineageViruses > Riboviria > Orthornavirae > Kitrinoviricota > Alsuviricetes > Martellivirales > Bromoviridae > Cucumovirus > Cucumber mosaic virus
- Virus hosts
Accessions
- Primary accessionP0C783
Proteomes
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 1-3 | Loss of cell-to-cell movement. | ||||
Sequence: MEL → AAA | ||||||
Mutagenesis | 10-12 | Loss of gene silencing suppressor function. | ||||
Sequence: NVE → AAA | ||||||
Mutagenesis | 22-24 | Loss of gene silencing suppressor function. | ||||
Sequence: KKQ → AAA | ||||||
Mutagenesis | 31-33 | Loss of gene silencing suppressor function. | ||||
Sequence: QNR → AAA | ||||||
Mutagenesis | 34-36 | Loss of gene silencing suppressor function. | ||||
Sequence: RER → AAA | ||||||
Mutagenesis | 40-42 | Loss of gene silencing suppressor function. | ||||
Sequence: SPS → AAA | ||||||
Mutagenesis | 55-57 | Loss of gene silencing suppressor function. | ||||
Sequence: LPF → AAA | ||||||
Mutagenesis | 70-72 | Loss of cell-to-cell movement. | ||||
Sequence: RHV → AAA |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000399910 | 1-110 | Suppressor of silencing 2b | |||
Sequence: MELNVGAMTNVELQLARMVEAKKQRRRSHKQNRRERGHKSPSERARSNLRLFRFLPFYQVDGSELTGSCRHVNVAELPESEASRLELSAEDHDFDDTDWFAGNEWAEGAF |
Family & Domains
Features
Showing features for region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 16-45 | Disordered | ||||
Sequence: ARMVEAKKQRRRSHKQNRRERGHKSPSERA | ||||||
Motif | 22-27 | Nuclear localization signal | ||||
Sequence: KKQRRR |
Sequence similarities
Belongs to the cucumovirus/ilarvirus protein 2b family.
Family and domain databases
Sequence
- Sequence statusComplete
- Length110
- Mass (Da)12,749
- Last updated2010-11-02 v1
- Checksum59690777E7D64128
Keywords
- Technical term