P0AFP2 · ATL_ECOLI
- ProteinDNA base-flipping protein
- Geneatl
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids129 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Involved in DNA damage recognition. Binds DNA containing O6-methylguanine and larger O6-alkylguanine adducts, and to double-stranded DNA that contains an AP (apurinic/apyrimidinic) site (PubMed:16027108, PubMed:18084297, PubMed:19269902, PubMed:20921378).
Binds to the damaged base and flips the base out of the DNA duplex into an extrahelical conformation, which allows processing by repair proteins (PubMed:18084297).
Works in partnership with the nucleotide excision repair (NER) pathway to enhance the repair of the O6-alkylguanine adducts larger than the methyl adduct (PubMed:19269902, PubMed:20921378).
Also prevents methyl-directed mismatch repair (MMR)-mediated attack of the O6-alkylguanine:T mispairs for the larger alkyl groups (PubMed:20921378).
Binds to the damaged base and flips the base out of the DNA duplex into an extrahelical conformation, which allows processing by repair proteins (PubMed:18084297).
Works in partnership with the nucleotide excision repair (NER) pathway to enhance the repair of the O6-alkylguanine adducts larger than the methyl adduct (PubMed:19269902, PubMed:20921378).
Also prevents methyl-directed mismatch repair (MMR)-mediated attack of the O6-alkylguanine:T mispairs for the larger alkyl groups (PubMed:20921378).
Miscellaneous
Does not have alkyltransferase activity. A tryptophan residue replaces the cysteine at the known active site of MGMT.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 52 | Required for phosphate rotation/nucleotide flipping | ||||
Sequence: Y | ||||||
Site | 66 | Arg finger, required for nucleotide flipping | ||||
Sequence: R |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | catalytic activity | |
Molecular Function | damaged DNA binding | |
Biological Process | DNA repair |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA base-flipping protein
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Escherichia
Accessions
- Primary accessionP0AFP2
- Secondary accessions
Proteomes
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 83 | Does not confer alkyltransferase activity. | ||||
Sequence: W → C |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000139390 | 1-129 | DNA base-flipping protein | |||
Sequence: MLVSCAMRLHSGVFPDYAEKLPQEEKMEKEDSFPQRVWQIVAAIPEGYVTTYGDVAKLAGSPRAARQVGGVLKRLPEGSTLPWHRVVNRHGTISLTGPDLQRQRQALLAEGVMVSGSGQIDLQRYRWNY |
Proteomic databases
Interaction
Subunit
Interacts with HelD and UvrA.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P0AFP2 | uvrA P0A698 | 2 | EBI-560039, EBI-552091 |
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length129
- Mass (Da)14,450
- Last updated2005-12-20 v1
- Checksum584382A5657919CA
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U82664 EMBL· GenBank· DDBJ | AAB40210.1 EMBL· GenBank· DDBJ | Genomic DNA | Frameshift | |
U00096 EMBL· GenBank· DDBJ | AAC73557.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP009048 EMBL· GenBank· DDBJ | BAE76234.1 EMBL· GenBank· DDBJ | Genomic DNA |