P0AF40 · YIJD_ECOLI
- ProteinInner membrane protein YijD
- GeneyijD
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids119 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
Miscellaneous
Probably part of the fabR-yijD operon.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameInner membrane protein YijD
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Escherichia
Accessions
- Primary accessionP0AF40
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Cell inner membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-8 | Cytoplasmic | ||||
Sequence: MKQANQDR | ||||||
Transmembrane | 9-28 | Helical | ||||
Sequence: GTLLLALVAGLSINGTFAAL | ||||||
Topological domain | 29-31 | Periplasmic | ||||
Sequence: FSS | ||||||
Transmembrane | 32-50 | Helical | ||||
Sequence: IVPFSVFPIISLVLTVYCL | ||||||
Topological domain | 51-61 | Cytoplasmic | ||||
Sequence: HQRYLNRTMPV | ||||||
Transmembrane | 62-84 | Helical | ||||
Sequence: GLPGLAAACFILGVLLYSTVVRA | ||||||
Topological domain | 85-88 | Periplasmic | ||||
Sequence: EYPD | ||||||
Transmembrane | 89-108 | Helical | ||||
Sequence: IGSNFFPAVLSVIMVFWIGA | ||||||
Topological domain | 109-119 | Cytoplasmic | ||||
Sequence: KMRNRKQEVAE |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
No alteration in fatty acid composition.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000169698 | 1-119 | Inner membrane protein YijD | |||
Sequence: MKQANQDRGTLLLALVAGLSINGTFAALFSSIVPFSVFPIISLVLTVYCLHQRYLNRTMPVGLPGLAAACFILGVLLYSTVVRAEYPDIGSNFFPAVLSVIMVFWIGAKMRNRKQEVAE |
Proteomic databases
Structure
Sequence
- Sequence statusComplete
- Length119
- Mass (Da)13,024
- Last updated2005-12-20 v1
- Checksum29177570EAF20F3B
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 13 | in Ref. 1; CAA46824 | ||||
Sequence: L → LL | ||||||
Sequence conflict | 94 | in Ref. 1; CAA46824 | ||||
Sequence: F → L | ||||||
Sequence conflict | 100-110 | in Ref. 1; CAA46824 | ||||
Sequence: VIMVFWIGAKM → SLWCSGLARRW |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X66026 EMBL· GenBank· DDBJ | CAA46824.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U00006 EMBL· GenBank· DDBJ | AAC43070.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U00096 EMBL· GenBank· DDBJ | AAC76946.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP009048 EMBL· GenBank· DDBJ | BAE77347.1 EMBL· GenBank· DDBJ | Genomic DNA |