P0A8S9 · FLHD_ECOLI
- ProteinFlagellar transcriptional regulator FlhD
- GeneflhD
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids116 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Functions in complex with FlhC as a master transcriptional regulator that regulates transcription of several flagellar and non-flagellar operons by binding to their promoter region. Activates expression of class 2 flagellar genes, including fliA, which is a flagellum-specific sigma factor that turns on the class 3 genes. Also regulates genes whose products function in a variety of physiological pathways.
Miscellaneous
Has been reported to be involved in cell division regulation, but it was later shown that this is not the case.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | transcription regulator complex | |
Molecular Function | DNA binding | |
Biological Process | bacterial-type flagellum assembly | |
Biological Process | DNA-templated transcription | |
Biological Process | positive regulation of bacterial-type flagellum assembly | |
Biological Process | positive regulation of DNA-templated transcription |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameFlagellar transcriptional regulator FlhD
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Escherichia
Accessions
- Primary accessionP0A8S9
- Secondary accessions
Proteomes
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 2 | Partial swarming phenotype. | ||||
Sequence: H → A | ||||||
Mutagenesis | 28 | Partial swarming phenotype. Affects FlhD/FlhC complex formation. | ||||
Sequence: D → A | ||||||
Mutagenesis | 34 | Partial swarming phenotype. Affects FlhD/FlhC complex formation. | ||||
Sequence: F → A | ||||||
Mutagenesis | 35 | Partial swarming phenotype. Affects FlhD/FlhC complex formation. | ||||
Sequence: R → A | ||||||
Mutagenesis | 61 | Partial swarming phenotype. Affects FlhD/FlhC complex formation. | ||||
Sequence: N → A | ||||||
Mutagenesis | 82 | Partial swarming phenotype. Does not affect FlhD/FlhC complex formation, but affects DNA binding. | ||||
Sequence: S → A | ||||||
Mutagenesis | 83 | Partial swarming phenotype. Does not affect FlhD/FlhC complex formation, but affects DNA binding. | ||||
Sequence: R → A | ||||||
Mutagenesis | 84 | Partial swarming phenotype. Does not affect FlhD/FlhC complex formation, but affects DNA binding. | ||||
Sequence: V → A | ||||||
Mutagenesis | 91 | Partial swarming phenotype. Affects FlhD/FlhC complex formation. | ||||
Sequence: H → A | ||||||
Mutagenesis | 92 | Non-swarming phenotype. Affects FlhD/FlhC complex formation. | ||||
Sequence: T → A | ||||||
Mutagenesis | 94 | Non-swarming phenotype. Affects FlhD/FlhC complex formation. | ||||
Sequence: I → A | ||||||
Mutagenesis | 96 | Partial swarming phenotype. Affects FlhD/FlhC complex formation. | ||||
Sequence: L → A |
PTM/Processing
Features
Showing features for chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000182713 | 1-116 | Flagellar transcriptional regulator FlhD | |||
Sequence: MHTSELLKHIYDINLSYLLLAQRLIVQDKASAMFRLGINEEMATTLAALTLPQMVKLAETNQLVCHFRFDSHQTITQLTQDSRVDDLQQIHTGIMLSTRLLNDVNQPEEALRKKRA | ||||||
Disulfide bond | 65 | Interchain | ||||
Sequence: C |
Keywords
- PTM
Proteomic databases
Expression
Induction
Expression is regulated by a large number of systems, including induction by quorum sensing via the two-component regulatory system QseB/QseC, induction by cAMP-CRP, repression by high osmolarity via OmpR and repression by H-NS.
Interaction
Subunit
Homodimer; disulfide-linked. Forms a heterohexamer composed of two FlhC and four FlhD subunits. Each FlhC binds a FlhD dimer, forming a heterotrimer, and a hexamer assembles by dimerization of two heterotrimers.
Protein-protein interaction databases
Structure
Family & Domains
Domain
The C-terminal region contains a putative helix-turn-helix (HTH) motif, suggesting that this region may bind DNA.
Sequence similarities
Belongs to the FlhD family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length116
- Mass (Da)13,316
- Last updated2005-06-07 v1
- Checksum593287239E9A4C16
Sequence caution
Mass Spectrometry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M19439 EMBL· GenBank· DDBJ | AAA23787.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
U00096 EMBL· GenBank· DDBJ | AAC74962.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP009048 EMBL· GenBank· DDBJ | BAA15713.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation |