P0A703 · HYBF_ECOLI
- ProteinHydrogenase maturation factor HybF
- GenehybF
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids113 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in the maturation of [NiFe] hydrogenases. Required for nickel insertion into the metal center of the hydrogenase. HybF is involved in maturation of hydrogenases 1 and 2. It may partially substitute for the function of HypA and vice versa.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 2 | Ni2+ (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 3 | Ni2+ (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 73 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 76 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 89 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 92 | Zn2+ (UniProtKB | ChEBI) | ||||
Sequence: C |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | metallochaperone activity | |
Molecular Function | nickel cation binding | |
Molecular Function | zinc ion binding | |
Biological Process | protein maturation | |
Biological Process | protein modification process |
Keywords
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameHydrogenase maturation factor HybF
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Escherichia
Accessions
- Primary accessionP0A703
- Secondary accessions
Proteomes
Phenotypes & Variants
Disruption phenotype
Deletion of the gene severely reduces hydrogenase 1 and hydrogenase 2 activity (PubMed:12081959).
HypA-hybF double mutant is completely blocked in maturation of hydrogenases 1, 2 and 3. However, the inclusion of high nickel concentrations in the medium can restore limited activity of all three hydrogenases (PubMed:12081959).
HypA-hybF double mutant is completely blocked in maturation of hydrogenases 1, 2 and 3. However, the inclusion of high nickel concentrations in the medium can restore limited activity of all three hydrogenases (PubMed:12081959).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 2 | Loss of activity. | ||||
Sequence: H → A | ||||||
Mutagenesis | 2 | Loss of activity. Does not affect the amount of zinc, but shows a strong decrease in nickel content. | ||||
Sequence: H → Q | ||||||
Mutagenesis | 3 | Loss of activity. | ||||
Sequence: E → L | ||||||
Mutagenesis | 3 | Does not affect activity. | ||||
Sequence: E → Q | ||||||
Mutagenesis | 73 | Affects stability and solubility of the protein, but mutant is still active. | ||||
Sequence: C → A | ||||||
Mutagenesis | 76 | Affects stability and solubility of the protein, but mutant is still active. | ||||
Sequence: C → A | ||||||
Mutagenesis | 89 | Affects stability and solubility of the protein, but mutant is still active. | ||||
Sequence: C → A or S | ||||||
Mutagenesis | 90 | Does not affect activity. | ||||
Sequence: P → A | ||||||
Mutagenesis | 92 | Affects stability and solubility of the protein, but mutant is still active. | ||||
Sequence: C → A |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000129063 | 1-113 | Hydrogenase maturation factor HybF | |||
Sequence: MHELSLCQSAVEIIQRQAEQHDVKRVTAVWLEIGALSCVEESAVRFSFEIVCHGTVAQGCDLHIVYKPAQAWCWDCSQVVEIHQHDAQCPLCHGERLRVDTGDSLIVKSIEVE |
Proteomic databases
Structure
Sequence
- Sequence statusComplete
- Length113
- Mass (Da)12,697
- Last updated2005-06-07 v1
- Checksum70919C4A40CEABE6
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U09177 EMBL· GenBank· DDBJ | AAA21594.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
U28377 EMBL· GenBank· DDBJ | AAA69158.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U00096 EMBL· GenBank· DDBJ | AAC76027.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP009048 EMBL· GenBank· DDBJ | BAE77052.1 EMBL· GenBank· DDBJ | Genomic DNA |