P0A700 · HYPA_ECOLI
- ProteinHydrogenase maturation factor HypA
- GenehypA
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids116 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in the maturation of [NiFe] hydrogenases. Required for nickel insertion into the metal center of the hydrogenase (PubMed:12081959, PubMed:15995183).
Mediates transfer of nickel, but not zinc, from the low-affinity metal-binding site in the GTPase domain of HypB to HypA (PubMed:23899293, PubMed:27951644).
HypA is involved in maturation of hydrogenase 3. It may partially substitute for the function of HybF and vice versa (PubMed:12081959).
May act as a scaffold for assembly of the nickel insertion proteins with the hydrogenase precursor protein after delivery of the iron center (PubMed:22016389).
Mediates transfer of nickel, but not zinc, from the low-affinity metal-binding site in the GTPase domain of HypB to HypA (PubMed:23899293, PubMed:27951644).
HypA is involved in maturation of hydrogenase 3. It may partially substitute for the function of HybF and vice versa (PubMed:12081959).
May act as a scaffold for assembly of the nickel insertion proteins with the hydrogenase precursor protein after delivery of the iron center (PubMed:22016389).
Activity regulation
GDP-loaded state of HypB enhances HypA-HypB complex formation and nickel transfer.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | GTPase complex | |
Cellular Component | plasma membrane | |
Molecular Function | identical protein binding | |
Molecular Function | metallochaperone activity | |
Molecular Function | nickel cation binding | |
Molecular Function | zinc ion binding | |
Biological Process | protein maturation | |
Biological Process | protein maturation by nickel ion transfer | |
Biological Process | protein modification process | |
Biological Process | protein-containing complex assembly |
Keywords
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHydrogenase maturation factor HypA
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Escherichia
Accessions
- Primary accessionP0A700
- Secondary accessions
Proteomes
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Disruption of the gene prevents development of hydrogenase 3 activity, does not influence the level of hydrogenase 1 and leads to a considerable increase in hydrogenase 2 activity (PubMed:1482271).
HypA-hybF double mutant is completely blocked in maturation of hydrogenases 1, 2 and 3. However, the inclusion of high nickel concentrations in the medium can restore limited activity of all three hydrogenases (PubMed:12081959).
HypA-hybF double mutant is completely blocked in maturation of hydrogenases 1, 2 and 3. However, the inclusion of high nickel concentrations in the medium can restore limited activity of all three hydrogenases (PubMed:12081959).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 2 | Does not affect interaction with HycE. | ||||
Sequence: H → A | ||||||
Mutagenesis | 2 | Can bind nickel, but with reduced affinity. Decreases nickel transfer from HypB and cannot support hydrogenase maturation. | ||||
Sequence: H → Q |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000129057 | 1-116 | Hydrogenase maturation factor HypA | |||
Sequence: MHEITLCQRALELIEQQAAKHGAKRVTGVWLKIGAFSCVETSSLAFCFDLVCRGSVAEGCKLHLEEQEAECWCETCQQYVTLLTQRVRRCPQCHGDMLQIVADDGLQIRRIEIDQE |
Proteomic databases
Interaction
Subunit
Homodimer (PubMed:15995183).
Forms complexes with HypB and SlyD, and interacts with HycE, the large subunit of hydrogenase 3 (PubMed:15995183, PubMed:22016389, PubMed:23899293).
Forms complexes with HypB and SlyD, and interacts with HycE, the large subunit of hydrogenase 3 (PubMed:15995183, PubMed:22016389, PubMed:23899293).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | P0A700 | hycE P16431 | 14 | EBI-6290024, EBI-552702 | |
BINARY | P0A700 | hypA P0A700 | 4 | EBI-6290024, EBI-6290024 | |
BINARY | P0A700 | hypB P0AAN3 | 9 | EBI-6290024, EBI-558261 |
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length116
- Mass (Da)13,168
- Last updated2005-06-07 v1
- Checksum57458941783073D4
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X54543 EMBL· GenBank· DDBJ | CAA38412.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U29579 EMBL· GenBank· DDBJ | AAA69236.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U00096 EMBL· GenBank· DDBJ | AAC75768.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP009048 EMBL· GenBank· DDBJ | BAE76803.1 EMBL· GenBank· DDBJ | Genomic DNA |