P09321 · PR3B1_RAT
- ProteinProlactin-3B1
- GenePrl3b1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids221 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | extracellular space | |
Molecular Function | hormone activity | |
Molecular Function | prolactin receptor binding | |
Biological Process | female pregnancy | |
Biological Process | mammary gland development | |
Biological Process | positive regulation of cell population proliferation | |
Biological Process | positive regulation of lactation | |
Biological Process | positive regulation of receptor signaling pathway via JAK-STAT | |
Biological Process | response to nutrient levels |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameProlactin-3B1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionP09321
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 2 variants from UniProt as well as other sources including ClinVar and dbSNP.
Chemistry
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-30 | |||||
Sequence: MQLSLTQPCFSGTLLMLAVSTLLLWEQVTS | ||||||
Chain | PRO_0000032965 | 31-221 | Prolactin-3B1 | |||
Sequence: APNYRMSTGSLYQRVVELSHYTHDLASKVFIEFDMKFGRTVWTHNLMLSPCHTAAIPTPENSEQVHQAKSEDLLKVSITILQAWQEPLKHIVAAVATLPDGSDTLLSRTKELEERIQGLLEGLETILSRVQPGAVGSDYTFWSEWSDLQSSDKSTKNGVLSVLYRCMRRDTHKVDNFLKVLKCRDIYNNNC | ||||||
Disulfide bond | 81↔196 | |||||
Sequence: CHTAAIPTPENSEQVHQAKSEDLLKVSITILQAWQEPLKHIVAAVATLPDGSDTLLSRTKELEERIQGLLEGLETILSRVQPGAVGSDYTFWSEWSDLQSSDKSTKNGVLSVLYRC | ||||||
Disulfide bond | 213↔221 | |||||
Sequence: CRDIYNNNC |
Keywords
- PTM
Proteomic databases
Expression
Developmental stage
Placental lactogen II is expressed from days 12 to term of pregnancy.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length221
- Mass (Da)25,007
- Last updated1999-07-15 v2
- Checksum36F23B647705DDF7
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8I6GKK0 | A0A8I6GKK0_RAT | Prl3b1 | 218 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 1 | in Ref. 1; AAA41887 | ||||
Sequence: M → V |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M13749 EMBL· GenBank· DDBJ | AAA41887.1 EMBL· GenBank· DDBJ | mRNA | ||
AF026298 EMBL· GenBank· DDBJ | AAC06277.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF026294 EMBL· GenBank· DDBJ | AAC06277.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF026295 EMBL· GenBank· DDBJ | AAC06277.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF026297 EMBL· GenBank· DDBJ | AAC06277.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC097255 EMBL· GenBank· DDBJ | AAH97255.1 EMBL· GenBank· DDBJ | mRNA |