P08962 · CD63_HUMAN
- ProteinCD63 antigen
- GeneCD63
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids238 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Functions as a cell surface receptor for TIMP1 and plays a role in the activation of cellular signaling cascades. Plays a role in the activation of ITGB1 and integrin signaling, leading to the activation of AKT, FAK/PTK2 and MAP kinases. Promotes cell survival, reorganization of the actin cytoskeleton, cell adhesion, spreading and migration, via its role in the activation of AKT and FAK/PTK2. Plays a role in VEGFA signaling via its role in regulating the internalization of KDR/VEGFR2. Plays a role in intracellular vesicular transport processes, and is required for normal trafficking of the PMEL luminal domain that is essential for the development and maturation of melanocytes. Plays a role in the adhesion of leukocytes onto endothelial cells via its role in the regulation of SELP trafficking. May play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, but not in mast cell degranulation in response to other stimuli.
Miscellaneous
Lack of expression of CD63 in platelets has been observed in a patient with Hermansky-Pudlak syndrome (HPS). Hermansky-Pudlak syndrome (HPS) is a genetically heterogeneous, rare, autosomal recessive disorder characterized by oculocutaneous albinism, bleeding due to platelet storage pool deficiency, and lysosomal storage defects. This syndrome results from defects of diverse cytoplasmic organelles including melanosomes, platelet dense granules and lysosomes. Ceroid storage in the lungs is associated with pulmonary fibrosis, a common cause of premature death in individuals with HPS.
This antigen is associated with early stages of melanoma tumor progression.
GO annotations
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameCD63 antigen
- Alternative names
- CD Antigen Name
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP08962
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Lysosome membrane ; Multi-pass membrane protein
Late endosome membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 2-11 | Cytoplasmic | ||||
Sequence: AVEGGMKCVK | ||||||
Transmembrane | 12-32 | Helical | ||||
Sequence: FLLYVLLLAFCACAVGLIAVG | ||||||
Topological domain | 33-51 | Extracellular | ||||
Sequence: VGAQLVLSQTIIQGATPGS | ||||||
Transmembrane | 52-72 | Helical | ||||
Sequence: LLPVVIIAVGVFLFLVAFVGC | ||||||
Topological domain | 73-81 | Cytoplasmic | ||||
Sequence: CGACKENYC | ||||||
Transmembrane | 82-102 | Helical | ||||
Sequence: LMITFAIFLSLIMLVEVAAAI | ||||||
Topological domain | 103-203 | Extracellular | ||||
Sequence: AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV | ||||||
Transmembrane | 204-224 | Helical | ||||
Sequence: LVVAAAALGIAFVEVLGIVFA | ||||||
Topological domain | 225-238 | Cytoplasmic | ||||
Sequence: CCLVKSIRSGYEVM |
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 287 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, chain, modified residue (large scale data), glycosylation.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Initiator methionine | 1 | UniProt | Removed | ||||
Sequence: M | |||||||
Chain | PRO_0000219216 | 2-238 | UniProt | CD63 antigen | |||
Sequence: AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM | |||||||
Modified residue (large scale data) | 113 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Glycosylation | 130 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 150 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 172 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
Palmitoylated at a low, basal level in unstimulated platelets. The level of palmitoylation increases when platelets are activated by thrombin (in vitro).
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Detected in platelets (at protein level). Dysplastic nevi, radial growth phase primary melanomas, hematopoietic cells, tissue macrophages.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with TIMP1 and ITGB1 and recruits TIMP1 to ITGB1 (PubMed:16917503, PubMed:24635319).
Interacts with CD9. Identified in a complex with CD9 and ITGB3 (PubMed:19640571).
Interacts with PMEL (PubMed:21962903).
Interacts with KDR/VEGFR2; identified in a complex with ITGB1 and KDR/VEGFR2 and is required to recruit KDR to ITGB1 complexes (PubMed:23632027).
Interacts with SYT7 (By similarity).
Interacts with CD9. Identified in a complex with CD9 and ITGB3 (PubMed:19640571).
Interacts with PMEL (PubMed:21962903).
Interacts with KDR/VEGFR2; identified in a complex with ITGB1 and KDR/VEGFR2 and is required to recruit KDR to ITGB1 complexes (PubMed:23632027).
Interacts with SYT7 (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
XENO | P08962 | env PRO_0000038428 P04578 | 4 | EBI-762053, EBI-6179711 | |
BINARY | P08962 | TIMP1 P01033 | 8 | EBI-762053, EBI-712536 | |
BINARY | P08962 | TMEM80 Q96HE8 | 3 | EBI-762053, EBI-11742770 |
Protein-protein interaction databases
Chemistry
Miscellaneous
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 234-238 | Lysosomal targeting motif | ||||
Sequence: GYEVM |
Sequence similarities
Belongs to the tetraspanin (TM4SF) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
P08962-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length238
- Mass (Da)25,637
- Last updated2007-01-23 v2
- Checksum85AC8E235C6E425F
P08962-2
- Name2
- Differences from canonical
- 23-45: Missing
P08962-3
- Name3
- Differences from canonical
- 1-82: Missing
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, sequence conflict.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X07982 EMBL· GenBank· DDBJ | CAA30792.1 EMBL· GenBank· DDBJ | mRNA | ||
M59907 EMBL· GenBank· DDBJ | AAA63235.1 EMBL· GenBank· DDBJ | mRNA | ||
M58485 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
S93788 EMBL· GenBank· DDBJ | AAB21617.1 EMBL· GenBank· DDBJ | mRNA | ||
X62654 EMBL· GenBank· DDBJ | CAA44519.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF508304 EMBL· GenBank· DDBJ | AAM34259.1 EMBL· GenBank· DDBJ | mRNA | ||
AK311893 EMBL· GenBank· DDBJ | BAG34834.1 EMBL· GenBank· DDBJ | mRNA | ||
CR542096 EMBL· GenBank· DDBJ | CAG46893.1 EMBL· GenBank· DDBJ | mRNA | ||
BT007073 EMBL· GenBank· DDBJ | AAP35736.1 EMBL· GenBank· DDBJ | mRNA | ||
BT020137 EMBL· GenBank· DDBJ | AAV38939.1 EMBL· GenBank· DDBJ | mRNA | ||
BT020138 EMBL· GenBank· DDBJ | AAV38940.1 EMBL· GenBank· DDBJ | mRNA | ||
AC009779 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471054 EMBL· GenBank· DDBJ | EAW96827.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC002349 EMBL· GenBank· DDBJ | AAH02349.1 EMBL· GenBank· DDBJ | mRNA | ||
BC013017 EMBL· GenBank· DDBJ | AAH13017.1 EMBL· GenBank· DDBJ | mRNA |