P08730 · K1C13_MOUSE
- ProteinKeratin, type I cytoskeletal 13
- GeneKrt13
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids437 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Type 1 keratin (Probable). Maintains postnatal tongue mucosal cell homeostasis and tissue organization in response to mechanical stress, potentially via regulation of the G1/S phase cyclins CCNE1 and CCNE2 (PubMed:32758484).
Miscellaneous
There are two types of cytoskeletal and microfibrillar keratin: I (acidic; 40-55 kDa) and II (neutral to basic; 56-70 kDa).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoskeleton | |
Cellular Component | keratin filament | |
Molecular Function | structural molecule activity | |
Biological Process | cellular response to retinoic acid | |
Biological Process | epithelial cell differentiation | |
Biological Process | intermediate filament organization | |
Biological Process | regulation of translation in response to stress | |
Biological Process | tongue morphogenesis |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameKeratin, type I cytoskeletal 13
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionP08730
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Knockout mice maintain a normal body weight and developmental phenotype (PubMed:32758484).
Tongue histological abnormalities are evident at P20 including the loss of two lingual vessel branches at the ventral side of the tongue which appears white and wrinkled, especially on the ventral surface at three weeks of age (PubMed:32758484).
Loss of column-like basal cell organization and increase in nuclear atypia and vacuolization in both the basal and suprabasal layers of the tongue (PubMed:32758484).
Loss of keratohyalin granules, abnormal presence of cuboidal cells in the suprabasal layers and loss of organization of the outermost keratin layer leading to a foamy appearance (PubMed:32758484).
Increase in intracellular gaps, however desmosomes still formed but were found broken and intermediate filaments running from the desmosomes to the cytoplasm were missing or reduced (PubMed:32758484).
Cytoplasmic vacuolization is evident in all cell layers and large lipid droplets are found in granular cells in the tongue epithelia (PubMed:32758484).
Severe abnormalities in buccal mucosa and esophagus including thickened epithelium, immature suprabasal cells, loss of keratohyalin granules and a disorganized keratin layer at P20 (PubMed:32758484).
Disrupted proliferation and differentiation in tongue epithelial cells at P20, as indicated by disordered expression of the transcription factor Tp63/P63, the basal progenitor cell marker Krt5, and the differentiated epithelial cell marker Loricrin (PubMed:32758484).
Increase in proliferating cells in the upper layers of the tongue epithelium at P20 (PubMed:32758484).
Normal tongue morphology, structural architecture and epithelial cell proliferation at birth (PubMed:32758484).
Differential expression of 125 genes in the tongue at P0, enriched in keratinization, proinflammatory responses, stress-activated protein kinase signaling and threonine/lipid metabolic processes (PubMed:32758484).
Differential expression of 2907 genes in the ventral tongue at P20 involved in a range of processes, however primarily in cell cycle regulatory pathways (PubMed:32758484).
Increase in the expression of CCNE1 and CCNE2 in response to in vitro mechanical stress of the tongue (PubMed:32758484).
Tongue histological abnormalities are evident at P20 including the loss of two lingual vessel branches at the ventral side of the tongue which appears white and wrinkled, especially on the ventral surface at three weeks of age (PubMed:32758484).
Loss of column-like basal cell organization and increase in nuclear atypia and vacuolization in both the basal and suprabasal layers of the tongue (PubMed:32758484).
Loss of keratohyalin granules, abnormal presence of cuboidal cells in the suprabasal layers and loss of organization of the outermost keratin layer leading to a foamy appearance (PubMed:32758484).
Increase in intracellular gaps, however desmosomes still formed but were found broken and intermediate filaments running from the desmosomes to the cytoplasm were missing or reduced (PubMed:32758484).
Cytoplasmic vacuolization is evident in all cell layers and large lipid droplets are found in granular cells in the tongue epithelia (PubMed:32758484).
Severe abnormalities in buccal mucosa and esophagus including thickened epithelium, immature suprabasal cells, loss of keratohyalin granules and a disorganized keratin layer at P20 (PubMed:32758484).
Disrupted proliferation and differentiation in tongue epithelial cells at P20, as indicated by disordered expression of the transcription factor Tp63/P63, the basal progenitor cell marker Krt5, and the differentiated epithelial cell marker Loricrin (PubMed:32758484).
Increase in proliferating cells in the upper layers of the tongue epithelium at P20 (PubMed:32758484).
Normal tongue morphology, structural architecture and epithelial cell proliferation at birth (PubMed:32758484).
Differential expression of 125 genes in the tongue at P0, enriched in keratinization, proinflammatory responses, stress-activated protein kinase signaling and threonine/lipid metabolic processes (PubMed:32758484).
Differential expression of 2907 genes in the ventral tongue at P20 involved in a range of processes, however primarily in cell cycle regulatory pathways (PubMed:32758484).
Increase in the expression of CCNE1 and CCNE2 in response to in vitro mechanical stress of the tongue (PubMed:32758484).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 22 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000063648 | 1-437 | Keratin, type I cytoskeletal 13 | |||
Sequence: MSCRFQSSSMSYGGGFGAGSCQLGGGRNISSCSSRFVTGGSAGGYGGGMSCGFGGGAGGGFGGGFGGGFGGSYGGGFGGGFGDFGGVDGGLLSGNEKITMQNLNDRLASYLDKVRALEAANADLEVKIRDWHLKQSPASPERDYSAYYKTIEELRIKILEATTDNNRIILEIDNARLAADDFRLKYENELTLRQSVEADINGLRRVLDELTLAKTDLEMQIESLNEELAYLKKNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEALAEKNRRDAEEWFQTKSAELNKEVSSNAEMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLESTLAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMTGFNSGGNNTTTSNGSPSSNSGRPDFRKY | ||||||
Modified residue | 27 | Omega-N-methylarginine | ||||
Sequence: R | ||||||
Modified residue | 35 | Omega-N-methylarginine | ||||
Sequence: R |
Post-translational modification
O-glycosylated; glycans consist of single N-acetylglucosamine residues.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in tongue epithelia (at protein level) (PubMed:1695590).
Expressed in upper suprabasal layers of the corneal epithelium (at protein level) (PubMed:26758872).
Expressed in upper suprabasal layers of the corneal epithelium (at protein level) (PubMed:26758872).
Developmental stage
Expressed in the oral mucosa, including the palate, dorsal tongue, ventral tongue, and the floor of the mouth at 17.5 dpc (PubMed:32758484).
Expressed in basal cells and differentiated keratinocytes at the ventral surface and the oral interpapillary cell column on the dorsal surface of the tongue at birth (PubMed:32758484).
Ubiquitously expressed in basal cells and differentiated keratinocytes on the ventral tongue epithelium, however expression was limited to the cells in the interpapillary region and keratinized layer on the dorsal tongue at postnatal day 20 (P20) (PubMed:32758484).
Also expressed in the buccal mucosa and esophagus at P20 (PubMed:32758484).
Expressed in basal cells and differentiated keratinocytes at the ventral surface and the oral interpapillary cell column on the dorsal surface of the tongue at birth (PubMed:32758484).
Ubiquitously expressed in basal cells and differentiated keratinocytes on the ventral tongue epithelium, however expression was limited to the cells in the interpapillary region and keratinized layer on the dorsal tongue at postnatal day 20 (P20) (PubMed:32758484).
Also expressed in the buccal mucosa and esophagus at P20 (PubMed:32758484).
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-95 | Head | ||||
Sequence: MSCRFQSSSMSYGGGFGAGSCQLGGGRNISSCSSRFVTGGSAGGYGGGMSCGFGGGAGGGFGGGFGGGFGGSYGGGFGGGFGDFGGVDGGLLSGN | ||||||
Region | 96-131 | Coil 1A | ||||
Sequence: EKITMQNLNDRLASYLDKVRALEAANADLEVKIRDW | ||||||
Domain | 96-408 | IF rod | ||||
Sequence: EKITMQNLNDRLASYLDKVRALEAANADLEVKIRDWHLKQSPASPERDYSAYYKTIEELRIKILEATTDNNRIILEIDNARLAADDFRLKYENELTLRQSVEADINGLRRVLDELTLAKTDLEMQIESLNEELAYLKKNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEALAEKNRRDAEEWFQTKSAELNKEVSSNAEMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLESTLAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKM | ||||||
Region | 132-150 | Linker 1 | ||||
Sequence: HLKQSPASPERDYSAYYKT | ||||||
Region | 151-242 | Coil 1B | ||||
Sequence: IEELRIKILEATTDNNRIILEIDNARLAADDFRLKYENELTLRQSVEADINGLRRVLDELTLAKTDLEMQIESLNEELAYLKKNHEEEMKEF | ||||||
Region | 243-265 | Linker 12 | ||||
Sequence: SNQVVGQVNVEMDATPGIDLTRV | ||||||
Region | 266-404 | Coil 2 | ||||
Sequence: LAEMREQYEALAEKNRRDAEEWFQTKSAELNKEVSSNAEMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLESTLAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQ | ||||||
Region | 405-437 | Tail | ||||
Sequence: DAKMTGFNSGGNNTTTSNGSPSSNSGRPDFRKY | ||||||
Region | 408-437 | Disordered | ||||
Sequence: MTGFNSGGNNTTTSNGSPSSNSGRPDFRKY | ||||||
Compositional bias | 409-431 | Polar residues | ||||
Sequence: TGFNSGGNNTTTSNGSPSSNSGR |
Sequence similarities
Belongs to the intermediate filament family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P08730-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length437
- Mass (Da)47,754
- Last updated1996-10-01 v2
- Checksum924128DBAC317E2F
P08730-2
- Name2
- Differences from canonical
- 300-425: Missing
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_016378 | 300-425 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 409-431 | Polar residues | ||||
Sequence: TGFNSGGNNTTTSNGSPSSNSGR |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U13921 EMBL· GenBank· DDBJ | AAC52150.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK132640 EMBL· GenBank· DDBJ | BAE21276.1 EMBL· GenBank· DDBJ | mRNA | ||
BC060286 EMBL· GenBank· DDBJ | AAH60286.1 EMBL· GenBank· DDBJ | mRNA | ||
X53320 EMBL· GenBank· DDBJ | CAA37407.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
X03492 EMBL· GenBank· DDBJ | CAA27208.1 EMBL· GenBank· DDBJ | mRNA |