P08645 · RAP1_DROME
- ProteinRas-related protein Rap1
- GeneRap1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids184 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays a role in photoreceptor cell determination.
Catalytic activity
- GTP + H2O = GDP + H+ + phosphate
Activity regulation
Alternates between an inactive form bound to GDP and an active form bound to GTP. Activated by a guanine nucleotide-exchange factor (GEF) and inactivated by a GTPase-activating protein (GAP).
Features
Showing features for binding site.
GO annotations
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRas-related protein Rap1
- EC number
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionP08645
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Flies exhibit disruption of the early stages of photoreceptor cell determination, adult eyes lack the R7 cell.
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | 157 | in roughened mutants | ||||
Sequence: F → L |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1 variant from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue, lipidation, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000030191 | 1-181 | Ras-related protein Rap1 | |||
Sequence: MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTDDVPMVLVGNKCDLEEERVVGKELGKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQINKKSPEKKQKKPKKSLC | ||||||
Modified residue | 181 | Cysteine methyl ester | ||||
Sequence: C | ||||||
Lipidation | 181 | S-geranylgeranyl cysteine | ||||
Sequence: C | ||||||
Propeptide | PRO_0000030192 | 182-184 | Removed in mature form | |||
Sequence: VLL |
Keywords
- PTM
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 32-40 | Effector region | ||||
Sequence: YDPTIEDSY |
Sequence similarities
Belongs to the small GTPase superfamily. Ras family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length184
- Mass (Da)20,863
- Last updated1992-08-01 v2
- Checksum9A55889B61FEDE13
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
M9MRT6 | M9MRT6_DROME | Rap1 | 184 |
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 45-49 | in Ref. 1; CAA26131 | ||||
Sequence: EVDGQ → KVNER | ||||||
Sequence conflict | 56-57 | in Ref. 1; CAA26131 | ||||
Sequence: LD → VN | ||||||
Sequence conflict | 69 | in Ref. 1; CAA26131 | ||||
Sequence: D → N |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X02200 EMBL· GenBank· DDBJ | CAA26131.1 EMBL· GenBank· DDBJ | Genomic DNA | Frameshift | |
M80535 EMBL· GenBank· DDBJ | AAA28845.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF186654 EMBL· GenBank· DDBJ | AAF15520.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014296 EMBL· GenBank· DDBJ | AAF47583.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY121688 EMBL· GenBank· DDBJ | AAM52015.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ138746 EMBL· GenBank· DDBJ | ABA86352.1 EMBL· GenBank· DDBJ | Genomic DNA |