P08541 · UD2B2_RAT
- ProteinUDP-glucuronosyltransferase 2B2
- GeneUgt2b
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids530 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. 2B2 acts on various endogenous steroids, especially etiocholanolone and androsterone.
Catalytic activity
- glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H+ + UDPThis reaction proceeds in the forward direction.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum membrane | |
Molecular Function | glucuronosyltransferase activity | |
Biological Process | cellular glucuronidation | |
Biological Process | estrogen metabolic process |
Keywords
- Molecular function
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameUDP-glucuronosyltransferase 2B2
- EC number
- Short namesUDPGT 2B2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionP08541
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Microsome membrane ; Single-pass membrane protein
Endoplasmic reticulum membrane ; Single-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 494-510 | Helical | ||||
Sequence: VIGFLLTCFAVIAALTV |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-23 | |||||
Sequence: MPRKWISALFLLQISYCFKSGHC | ||||||
Chain | PRO_0000036026 | 24-530 | UDP-glucuronosyltransferase 2B2 | |||
Sequence: GKVLVWPMDFSHWMNIKIILDELVQRGHEVTVLKPSAYFFLDPKKSSDLKFEIFSTSISKDELQNHFIKLLDVWTYELPRDTCLSYSPILQNLVYEFSYFYLSICKDAVSNKQLMTKLQESKFDVLFADPVASCGDLIAELLHIPFLYSLSFSPGHKLEKSIGKFILPPSYVPVILSGLAGKMTFIDRVKNMICMLYFDFWFERLRHKEWDTFYSEILGRPTTVDETMSKVEIWLIRSYWDLKFPHPTLPNVDYIGGLHCKPAKPLPKDMEEFVQSSGEHGVVVFSLGSMVSNMTEEKANAIAWALAQIPQKVLWKFDGKTPATLGPNTRVYKWLPQNDLLGHPKTKAFVTHGGANGLYEAIYHGIPMIGIPLFGDQPDNIAHMVAKGAAVSLNIRTMSKLDFLSALEEVIDNPFYKKNVMLLSTIHHDQPMKPLDRAVFWIEFIMRHKGAKHLRPLGHNLPWYQYHSLDVIGFLLTCFAVIAALTVKCLLFMYRFFVKKEKKMKNE | ||||||
Glycosylation | 316 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
Autoacylation in vitro.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Induction
Constitutively expressed.
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length530
- Mass (Da)60,986
- Last updated1988-08-01 v1
- ChecksumF2FFF3E23E2D75B2
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F1LM22 | F1LM22_RAT | Ugt2b | 533 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 159 | in Ref. 3; CAA27198 | ||||
Sequence: D → E | ||||||
Sequence conflict | 286 | in Ref. 3; CAA27198 | ||||
Sequence: A → S | ||||||
Sequence conflict | 351 | in Ref. 3; CAA27198 | ||||
Sequence: N → I | ||||||
Sequence conflict | 363 | in Ref. 3; CAA27198 | ||||
Sequence: L → I |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
J02589 EMBL· GenBank· DDBJ | AAA42314.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
M74439 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
X03478 EMBL· GenBank· DDBJ | CAA27198.1 EMBL· GenBank· DDBJ | mRNA |