P08247 · SYPH_HUMAN
- ProteinSynaptophysin
- GeneSYP
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids313 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameSynaptophysin
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionP08247
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-25 | Cytoplasmic | ||||
Sequence: MLLLADMDVVNQLVAGGQFRVVKEP | ||||||
Transmembrane | 26-49 | Helical | ||||
Sequence: LGFVKVLQWVFAIFAFATCGSYSG | ||||||
Topological domain | 50-106 | Vesicular | ||||
Sequence: ELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEF | ||||||
Transmembrane | 107-130 | Helical | ||||
Sequence: FVTVAVFAFLYSMGALATYIFLQN | ||||||
Topological domain | 131-137 | Cytoplasmic | ||||
Sequence: KYRENNK | ||||||
Transmembrane | 138-161 | Helical | ||||
Sequence: GPMLDFLATAVFAFMWLVSSSAWA | ||||||
Topological domain | 162-199 | Vesicular | ||||
Sequence: KGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTS | ||||||
Transmembrane | 200-223 | Helical | ||||
Sequence: GLNTSVVFGFLNLVLWVGNLWFVF | ||||||
Topological domain | 224-313 | Cytoplasmic | ||||
Sequence: KETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Intellectual developmental disorder, X-linked 96 (XLID96)
- Note
- DescriptionA disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period.
- See alsoMIM:300802
Natural variants in XLID96
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_062986 | 217 | G>R | in XLID96; dbSNP:rs137852561 | |
VAR_062988 | 277 | D>E | in XLID96; uncertain significance | |
VAR_062989 | 293 | G>S | in XLID96; uncertain significance; dbSNP:rs139475570 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_062983 | 2 | in dbSNP:rs200470034 | |||
Sequence: L → Q | ||||||
Natural variant | VAR_079223 | 72 | ||||
Sequence: E → Q | ||||||
Natural variant | VAR_062984 | 158 | ||||
Sequence: S → L | ||||||
Natural variant | VAR_062985 | 166 | ||||
Sequence: D → N | ||||||
Natural variant | VAR_062986 | 217 | in XLID96; dbSNP:rs137852561 | |||
Sequence: G → R | ||||||
Natural variant | VAR_062987 | 248 | in dbSNP:rs782086106 | |||
Sequence: D → N | ||||||
Natural variant | VAR_062988 | 277 | in XLID96; uncertain significance | |||
Sequence: D → E | ||||||
Natural variant | VAR_062989 | 293 | in XLID96; uncertain significance; dbSNP:rs139475570 | |||
Sequence: G → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 285 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, glycosylation, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000179161 | 1-313 | Synaptophysin | |||
Sequence: MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM | ||||||
Glycosylation | 59 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Modified residue | 81 | Phosphotyrosine | ||||
Sequence: Y |
Post-translational modification
Ubiquitinated; mediated by SIAH1 or SIAH2 and leading to its subsequent proteasomal degradation.
Phosphorylated by SRC.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the brain, with expression in the hippocampus, the neuropil in the dentate gyrus, where expression is higher in the outer half of the molecular layer than in the inner half, and in the neuropil of CA4 and CA3 (PubMed:8838578).
Expressed in the putamen (at protein level) (PubMed:17296554).
Expressed in the putamen (at protein level) (PubMed:17296554).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Homohexamer or homotetramer. Interacts with SRCIN1 (PubMed:18662323).
Interacts with VAMP2; the interaction is inhibit by interaction of VAPM2 with SEPT8 (By similarity).
Interacts with VAMP2; the interaction is inhibit by interaction of VAPM2 with SEPT8 (By similarity).
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 21-227 | MARVEL | ||||
Sequence: VVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETG | ||||||
Region | 238-313 | Disordered | ||||
Sequence: GAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM | ||||||
Region | 254-305 | Repeats, Gly-rich | ||||
Sequence: GYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGA |
Domain
The calcium-binding activity is thought to be localized in the cytoplasmic tail of the protein.
Sequence similarities
Belongs to the synaptophysin/synaptobrevin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
P08247-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length313
- Mass (Da)33,845
- Last updated1991-08-01 v3
- Checksum592289C43B12EFA7
P08247-2
- Name2
- Differences from canonical
- 1-118: Missing
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_056897 | 1-118 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 196 | in Ref. 7; AAH64550 | ||||
Sequence: P → L |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X06389 EMBL· GenBank· DDBJ | CAA29686.1 EMBL· GenBank· DDBJ | mRNA | ||
U93305 EMBL· GenBank· DDBJ | AAB92358.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK295524 EMBL· GenBank· DDBJ | BAH12095.1 EMBL· GenBank· DDBJ | mRNA | ||
AK313030 EMBL· GenBank· DDBJ | BAG35863.1 EMBL· GenBank· DDBJ | mRNA | ||
AK315953 EMBL· GenBank· DDBJ | BAH14324.1 EMBL· GenBank· DDBJ | mRNA | ||
AF196779 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471224 EMBL· GenBank· DDBJ | EAW50685.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC064550 EMBL· GenBank· DDBJ | AAH64550.1 EMBL· GenBank· DDBJ | mRNA |