P08153 · SWI5_YEAST
- ProteinTranscriptional factor SWI5
- GeneSWI5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids709 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Determines the mother-cell-specific transcription of the HO endonuclease gene that is responsible for the initiation of mating-type switching in yeast. Recognizes a specific sequence in the promoter of the HO gene. Activates EGT2 transcription in a concentration-dependent manner. Synthesized during G2 and early mitosis.
Miscellaneous
Present with 688 molecules/cell in log phase SD medium.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 647-659 | A.T hook | ||||
Sequence: PRKRGRPRKDGTS |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | mediator complex binding | |
Molecular Function | metal ion binding | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | RNA polymerase II transcription regulatory region sequence-specific DNA binding | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | exit from mitosis | |
Biological Process | G1/S transition of mitotic cell cycle | |
Biological Process | positive regulation of mating type switching | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTranscriptional factor SWI5
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionP08153
- Secondary accessions
Proteomes
Organism-specific databases
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 522 | Constitutive nuclear entry; when associated with A-646 and A-664. | ||||
Sequence: S → A | ||||||
Mutagenesis | 646 | Constitutive nuclear entry; when associated with A-522 and A-664. | ||||
Sequence: S → A | ||||||
Mutagenesis | 664 | Constitutive nuclear entry; when associated with A-522 and A-646. | ||||
Sequence: S → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 7 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000046855 | 1-709 | Transcriptional factor SWI5 | |||
Sequence: MDTSNSWFDASKVQSLNFDLQTNSYYSNARGSDPSSYAIEGEYKTLATDDLGNILNLNYGETNEVIMNEINDLNLPLGPLSDEKSVKVSTFSELIGNDWQSMNFDLENNSREVTLNATSLLNENRLNQDSGMTVYQKTMSDKPHDEKKISMADNLLSTINKSEINKGFDRNLGELLLQQQQELREQLRAQQEANKKLELELKQTQYKQQQLQATLENSDGPQFLSPKRKISPASENVEDVYANSLSPMISPPMSNTSFTGSPSRRNNRQKYCLQRKNSSGTVGPLCFQELNEGFNDSLISPKKIRSNPNENLSSKTKFITPFTPKSRVSSATSNSANITPNNLRLDFKINVEDQESEYSEKPLGLGIELLGKPGPSPTKSVSLKSASVDIMPTIPGSVNNTPSVNKVSLSSSYIDQYTPRGKQLHFSSISENALGINAATPHLKPPSQQARHREGVFNDLDPNVLTKNTDNEGDDNEENEPESRFVISETPSPVLKSQSKYEGRSPQFGTHIKEINTYTTNSPSKITRKLTTLPRGSIDKYVKEMPDKTFECLFPGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSHQEKAYACPCGKKFNREDALVVHRSRMICSGGKKYENVVIKRSPRKRGRPRKDGTSSVSSSPIKENINKDHNGQLMFKLEDQLRRERSYDGNGTGIMVSPMKTNQR | ||||||
Modified residue | 225 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 278 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 300 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 339 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 376 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 488 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 492 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 505 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 522 | Phosphoserine; by CDC28 | ||||
Sequence: S | ||||||
Modified residue | 646 | Phosphoserine; by CDC28 | ||||
Sequence: S | ||||||
Modified residue | 664 | Phosphoserine; by CDC28 | ||||
Sequence: S |
Post-translational modification
Cell cycle-dependent phosphorylation of three serine residues prevents SWI5 from entering the nucleus, and it accumulates in the cytoplasm. As a consequence of CDC28 kinase inactivation at the end of anaphase, the three serine residues are dephosphorylated and SWI5 enters the nucleus to activate transcription. It is then rapidly degraded. Threonine phosphorylation also seems to occur.
Phosphorylated by PHO85.
Keywords
- PTM
Proteomic databases
PTM databases
Structure
Family & Domains
Features
Showing features for region, zinc finger, motif, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 245-267 | Disordered | ||||
Sequence: LSPMISPPMSNTSFTGSPSRRNN | ||||||
Region | 443-483 | Disordered | ||||
Sequence: LKPPSQQARHREGVFNDLDPNVLTKNTDNEGDDNEENEPES | ||||||
Zinc finger | 550-574 | C2H2-type 1 | ||||
Sequence: FECLFPGCTKTFKRRYNIRSHIQTH | ||||||
Zinc finger | 580-604 | C2H2-type 2 | ||||
Sequence: YSCDHPGCDKAFVRNHDLIRHKKSH | ||||||
Zinc finger | 609-632 | C2H2-type 3 | ||||
Sequence: YACPCGKKFNREDALVVHRSRMIC | ||||||
Motif | 635-659 | Nuclear localization signal | ||||
Sequence: GKKYENVVIKRSPRKRGRPRKDGTS | ||||||
Region | 644-677 | Disordered | ||||
Sequence: KRSPRKRGRPRKDGTSSVSSSPIKENINKDHNGQ | ||||||
Compositional bias | 657-671 | Polar residues | ||||
Sequence: GTSSVSSSPIKENIN |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length709
- Mass (Da)79,775
- Last updated1988-08-01 v1
- ChecksumBEF5ED5BFB6E30F6
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 514 | in Ref. 4; AAU09695 | ||||
Sequence: E → K | ||||||
Compositional bias | 657-671 | Polar residues | ||||
Sequence: GTSSVSSSPIKENIN |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X06978 EMBL· GenBank· DDBJ | CAA30040.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z50046 EMBL· GenBank· DDBJ | CAA90369.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY723778 EMBL· GenBank· DDBJ | AAU09695.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006938 EMBL· GenBank· DDBJ | DAA11989.1 EMBL· GenBank· DDBJ | Genomic DNA |